SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014034 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014034
Domain Number 1 Region: 429-686
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.14e-76
Family Eukaryotic proteases 0.000000705
Further Details:      
 
Domain Number 2 Region: 19-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-34
Family Spermadhesin, CUB domain 0.00000287
Further Details:      
 
Domain Number 3 Region: 185-295
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-26
Family Spermadhesin, CUB domain 0.00000532
Further Details:      
 
Domain Number 4 Region: 369-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.0000419
Further Details:      
 
Domain Number 5 Region: 136-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family EGF-type module 0.00071
Further Details:      
 
Domain Number 6 Region: 299-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000361
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014034   Gene: ENSMODG00000011217   Transcript: ENSMODT00000014293
Sequence length 689
Comment pep:novel chromosome:BROADO5:4:366381824:366421353:1 gene:ENSMODG00000011217 transcript:ENSMODT00000014293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSPTTRLSLLLAMVLQQVGCGSWPEPLFGRLTSPGFPKVYPNNEEQSWNLIAPPGYRIRL
YFTHFNLELSYLCEYDFVKLYSGDKLLATLCGQESTDTEQAPGNHTFHSAGSNLRVAFRS
DFSNEKDFTGFEAFYAAEDIDECEVPPGADPICDHHCHNHLGGFYCSCRAGFRLHKDKRT
CSALCSGQVFTERSGVIMSPDYPQAYPKLSSCNYRIQVEDGFSVILEFEDSFDVETHPES
LCPYDVLKIKTDKEEYGPFCGQTSPPKINTRSHIVDIIFITDDSGDHTGWKIRYLTTALP
CPNPIAPPHGQITPVQPKYILKDHFSIACETGYHLQGGSLPLLACRPFPFGYTFFMLFLP
RLHLLVVDCGPPDDLRKGRVTYITGGEVTTYGAMIQYSCAGPFYAMKMNNDGKYRCGADG
FWKSSKGENSLPVCEPVCGLMSQRLVRVFGGRKATVGQFPWQVMLAGESLAGGALLYDNW
VLTAAHAIHAQDDLSTLQIRMGVLNRLSSHYTEAWADAVFIHEGYTHDEANFNNDIALIK
LKNHVEINSNVTPICLPRKNGSHVNTNDLGTVSGWGRTERNLRARHLMYVELPVVDQQTC
RAAFENKSSGGKPLVLTDNMICAGFPSGGKDACTGDSGGPLAFLDPETKTWFVGGIVSWG
VGCGEANQYGVYTNVINYIPWIENIILNN
Download sequence
Identical sequences F6S7Y6
ENSMODP00000014034 ENSMODP00000014034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]