SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014045 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014045
Domain Number 1 Region: 231-363
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-32
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 440-574
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-30
Family Cadherin 0.0016
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-22
Family Cadherin 0.011
Further Details:      
 
Domain Number 4 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 7.28e-22
Family Cadherin 0.0046
Further Details:      
 
Domain Number 5 Region: 575-665
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-16
Family Cadherin 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014045
Domain Number - Region: 33-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.00118
Family Cadherin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014045   Gene: ENSMODG00000011226   Transcript: ENSMODT00000014304
Sequence length 797
Comment pep:novel chromosome:BROADO5:1:333022532:333035690:1 gene:ENSMODG00000011226 transcript:ENSMODT00000014304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TIEPKEAMTPQQRQVLFLFVLLGVTGTASKLEQFSVVEEMERGSLVANVAKGLGLEDGEL
SNRGARVAFKGNKEYLQLHPKTGDLFLREKLDREKLCGPTEPCELPFQILLENPFQVVRA
ELRVQDINDHAPVFLDTEIILKISEITSTGTVFLLENAQDLDVGNNSLQNYTISPNSHFN
IQIRGDAEGRKYPELVLDKVLDREEQHEFRLTLTAVDGGVPPKSGTAQILVLVMDSNDNA
PVFSQSRYDVQIPEDSPINSLVVAVSAKDLDTGNNAEISYSLFRASQSIRKTFQLNEKSG
ELRLKQKLDFETCQSYTIDIQATDGGGLSGKCTVLVLVKDLNDNPPELTMSSLTTSIPEN
LPETAIAVFSVSDLDAGENGKIVCSIQDDLPFALKPSVENFYTLVTKGALDRESRNEYNI
TITIADLGFPRLKTEHNITIHISDINDNPPVFTQTTYKLYLQENNSPALHIGSVSAKDRD
SGINAKVTYSLLPPENGDLPLFSYISINSDNGHLYALRSLDYEAIQAFQFTVTATDGGSP
ALSSQALVQVVVLDENDNTPFVLYPLQNGTAPCNDLVPRAAEPGYLVTKVVAVDGDSGQN
SWLSYQLLKATDPGLFTVWAHNGEVCTARPISDRDATKQRLLVLVKDNGEPPQSAVATLN
VLLVDGFSEPYLQLPDAPKEQVQVDSLTIYLIISLAVISFLFLVSILMFIGVRLWKGKRD
ATDCSRFDSNGPFPGHLVDVTGTGTLSHSYQYEVCLTSNSGTSEFKFLKPVLPIVPPQAA
GRDSEENPSLRNSYMLT
Download sequence
Identical sequences F6S7K6
ENSMODP00000014045 ENSMODP00000014045 13616.ENSMODP00000014045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]