SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014055 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014055
Domain Number 1 Region: 231-363
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-31
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 440-574
Classification Level Classification E-value
Superfamily Cadherin-like 8.9e-30
Family Cadherin 0.0018
Further Details:      
 
Domain Number 3 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-21
Family Cadherin 0.0048
Further Details:      
 
Domain Number 4 Region: 341-444
Classification Level Classification E-value
Superfamily Cadherin-like 3.8e-21
Family Cadherin 0.0041
Further Details:      
 
Domain Number 5 Region: 576-665
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000144
Family Cadherin 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014055
Domain Number - Region: 25-97
Classification Level Classification E-value
Superfamily Cadherin-like 0.00171
Family Cadherin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014055   Gene: ENSMODG00000011237   Transcript: ENSMODT00000014314
Sequence length 796
Comment pep:novel chromosome:BROADO5:1:332997071:332999461:1 gene:ENSMODG00000011237 transcript:ENSMODT00000014314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMETGENTIRKQRQVLLFFVFLCMPKAGSEPRRFSVAEEMESGSFVGNVIKALGLEMGEL
SNRGARVVFEGVRQYLQFNRKTWDLLVKEKLDREELCGPTVSCVLPFQILLENPLQIFLA
ELLVEDINDHSPIFLDNEMLLKIPESSLPGKIIRLDGAQDLDVGINSLQNYTVSPNPHFQ
VQIRARSEGRKYPELVLNKALDREELPEIRLTLTALDGGSPPRSGTAQIRVLIVDVNDNA
PEFGRQNYEVRIPENSPPGSLVVEVHAADLDTGNYGEIFYTFSDASEDIRKTFKIDGSSG
EISLIKTVDFEATQFYEIDIEATDGGGLSGKCTVVIHVIDLNDNLPKLTISSITNPIPEN
SPETVVAVFRVSDLDSGENGRMVCSIQDDLPFSLKPSVENYYTLVTEGALDRERRAEYNI
TITVMDLGSPRLKTEHNITIWISDINDNPPVFTLTAYKLYLQENNSPALHIGSVSARDRD
SGINAKVTYSLLPPENGDLPLFSYISINSDNGHLYALRSLDYETIQAFQFTVTATDGGSP
SLSSQALVQVVVQDMNNNSPFVLYPLQNGTAPCNDLVPRTAEPGYLVTKVVAVDKNWGQN
SWLSYQLLKATDPGLFTVWAHNGEVRTARPISDRDAIKQRLLVLVKDNGQPPLSTAATLN
VLLVDGFSEPYMQFPDAPKEPIQTDSLTTYLVISLASVSFLFLVSVIMVIAIRLWNRKRD
ATDAAHFNPNGPFPSHLVDVSGTGTLSQSYQYEVCLTSGSETSEFKFLQPINPTLPQASG
KDTIENPTLRNSFCFN
Download sequence
Identical sequences F6S753
13616.ENSMODP00000014055 ENSMODP00000014055 ENSMODP00000014055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]