SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014174 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014174
Domain Number 1 Region: 32-491
Classification Level Classification E-value
Superfamily Cytochrome P450 1.3e-133
Family Cytochrome P450 0.000000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014174   Gene: ENSMODG00000011252   Transcript: ENSMODT00000014436
Sequence length 496
Comment pep:novel chromosome:BROADO5:1:10060250:10087263:-1 gene:ENSMODG00000011252 transcript:ENSMODT00000014436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWGLTTTVLLTCVLFLIFLSLWNHGTKKGKLPPGPTPLPIFGNLLQFDFKNMASTFSE
LAKKYGSIYTLYFGMQRVVVLHGYNIVKEALIDKGDIFMERGNVPIFEDTVKGQGVVFSR
GEKWKQIRRFSLMTLRNFGMGKRTIEERVQEEAQCLVEELRKTKGQPNDPTFILGCAPCN
VICSILFRERFNYKDEKFLYLMGLLNENFQLFNKPWIQLYNFLPAFRVHLPGKHKQLFKN
VEELKCFILERVKEHQEILDPNNPQDYIDCYLSKMQQEKNNPQSEFDVENLIMTALDLFA
AGTGTTSSTLRYGLLLILKHPEVQAKIHEEINRVIGHNRIPSIKDRQDMPYMDAVVHEVQ
RFIDLLPLNLPHAVNQDIQLQQYTIPKGTNIFPLLSPVLRDSKEFSNPDKFDPQHFLDKN
GSFKKSDYFMPFSAGKRACLGEGLARMELFLFLTTILQNFTLKPVGDPNEISVKNNHVGF
TNVPPYYQLCFLPHKA
Download sequence
Identical sequences F6WHZ8
ENSMODP00000014174 ENSMODP00000014174 XP_001377129.1.35504 13616.ENSMODP00000014174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]