SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014275 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014275
Domain Number 1 Region: 476-615
Classification Level Classification E-value
Superfamily FAS1 domain 1.83e-28
Family FAS1 domain 0.0026
Further Details:      
 
Domain Number 2 Region: 2173-2267
Classification Level Classification E-value
Superfamily C-type lectin-like 5.18e-28
Family Link domain 0.00022
Further Details:      
 
Domain Number 3 Region: 1682-1837
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-25
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 4 Region: 1530-1682
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-24
Family FAS1 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 940-1090
Classification Level Classification E-value
Superfamily FAS1 domain 6.67e-23
Family FAS1 domain 0.0033
Further Details:      
 
Domain Number 6 Region: 2264-2429
Classification Level Classification E-value
Superfamily FAS1 domain 2.88e-18
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 7 Region: 350-466
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000222
Family FAS1 domain 0.0059
Further Details:      
 
Domain Number 8 Region: 1096-1228
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000000366
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 9 Region: 199-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family EGF-type module 0.067
Further Details:      
 
Domain Number 10 Region: 1424-1480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000314
Family EGF-type module 0.074
Further Details:      
 
Domain Number 11 Region: 774-873,902-958
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000487
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014275
Domain Number - Region: 1471-1506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000223
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 2059-2096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Merozoite surface protein 1 (MSP-1) 0.086
Further Details:      
 
Domain Number - Region: 164-200
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000359
Family EGF-type module 0.054
Further Details:      
 
Domain Number - Region: 2105-2139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00121
Family EGF-type module 0.076
Further Details:      
 
Domain Number - Region: 1974-2101
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00314
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 244-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0093
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014275   Gene: ENSMODG00000011416   Transcript: ENSMODT00000014539
Sequence length 2538
Comment pep:novel chromosome:BROADO5:6:276504111:276565213:-1 gene:ENSMODG00000011416 transcript:ENSMODT00000014539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNVKTKFLTNTPCTSCAAFKNQDCPVGWSKNWEKESEDCSYTLTLGENSILIPGCTQKCS
KEVEEKACCPGFWGSQCYECPGGAQNPCNGHGACLDGIGQNGTCVCEEGFGGFACQDCRD
RSLFGPDCKSGKEAGDRHRLTGDGSCLCFAGYTGLGVTRVKLPACKALACPKNSQCVGAD
TGAPSCKCLPGFLLQASKCQAQNPCSPFPCSSFATCSALESGGFECRCKAGYHGDGKFCQ
PVDPCASNNGGCPSNTTKCVYQRPGKSSCVCKPGFYSLSSTISEGCRTSTRTCYHYFCDN
SATCQSDEQGKPKCVCKEGEIGNGRSCYGHFLRELERKKILRSSLRTLDTAISMLEKGCG
DILSKSGPFTVLVPYLYVTSSLNESMSRSLCKLHIIPGVHLIENGFQTTKTWWTLDGESL
TLSSNFRLKIYRYKDQPDQSYEVILANLPAANGIFHLVSSLRKQPSSAFIQGDPEKSIGK
ILASMDVFSRFETILENCGLPSILEGPGPFTVFVPSNSAVDSLRDGRLIYLFTEGISKLQ
ELVKYHIYSNAGLTVDKLISLKKIPTLANQVLMTNFTPEGRFLWRPSGIPLKSMDIVASN
GIIHLLDGILLPPSILPILPHRCNENQYTIVTGTCGDCQNQNTSVCPPNSQELDIFPKEC
FYIHDPDGLNVMRKGCARVCNQTTLKLGCCKGFFGPECSQCPGGFSNPCYGKGNCSDGIQ
GNGACICQKAFKGIACHVCADPNRHGEQCEEECGCVHGICDNRPGSGGICQKDTCTKGFT
GPFCNESLADCSPAGLAQYCHPLARCVTLQGRSKCVCPPGFQGDGFSCSTRHPCDQPDRG
GCSENAQCVRSPSEPHQCVCNKGWKGDGKDCVAINECELETRGGCHAEAQCHYIGPGQSS
CTCKPGFAGDGYQCSRINPCLVANGGCHVLATCRPQRDGGQPVCVCPDGYGGDGIACYGT
VLEELKRNNYFAGYYQWIKKAGFALPTKGNFTALVPSESAIQSMSPEDKAFWLQQQQLLH
LLRSHFVPDALTIRQLSDLSGQEVVTLNPPTRWEISNSSGKITIQNVSMEVADILATNGV
LHILSKVLLPSRKDVPLPRLSLRQQLDAIPSFSIFKKLLLQYGLLARIEAATAYTLFVPA
NSSVEDYCLKANLSTLDLETVKRHVLLGEALTPEAMRPGMHRNSLLGTSYELVFSSGQGS
QPLVNRVPVVGPTLQPQGGVVLQLGEVLTQRPNICLRSHIEGVRKKCSSCERKYRCPSGY
KKMQNAPPESCFYISNGIRTIGCYYTCIKKKEMPDCCPGYFGTLCDPCPGGAGSNCSGHG
QCQDGRLGNGECRCHEGFHGTACEGCELGRYGLNCAGVCNCGHGICQDGLLGNGTCSCNV
GWKGPHCDQEITASSCPEKCDPFANCINASCVCSAGYSGNGTNCSEVDPCVQDHGGCSLH
ANCTKVAPGQRTCTCKEGYAGDGEICLEINSCLSWNGGCHAKADCVPIGSSKVSCNCGAG
YTGDGIQSCVPFNPCTKDNGGCSPYATCNNTGPGERTCACGILTIGDGFTCRTRMGLELL
RDKDAAFFSHYLMEYQELKGEGPFTVFVPREDLMKNLTRRELSMLNTHRQLLFRYHTVGC
GRLLTQDLLEAGYVTTLSGHKLHFSQNEGNLYINEYAQVVTEDQIGVNGVIHFIDKLLLP
PEVVHWTDASSVPPKQNVTEAAESAGYTLFSKLLTMARMLPMFHDKAHQPLTVLWPSDEA
LKALSPERQAWLYHEDHREKLAAILRGHVIRNVKALASDIPNLGQLRTMHGSPISFSCSK
ALPGELLVGEGEARIVQRHMEFLGGIAYGIDQLLEPPGLGSRCDHYVKEQLPAYRQPCSS
CDLLPLCPLGYKDQGEVDYCMRAIPSRRPFFLRYTYYDPFLFSRKTQKSGCRRRCFTVTW
KPACCPGHYGIDCQVCPGGPGAPCNGNGVCDDGMTGTGVCKCHKGFNGTACELCAAGTFG
HQCLPCQCTAQGKCDEGVSGSGFCFCNEGWSGQRCEIKLDEQPVCSPPCHPQAVCRKDNF
CECSLDYEGDGRKCTVIDRCQNQHGGCSQHASCSQQGTVVTCTCLPDYEGDGVFCQARDP
CADGQNGGCSEHAECISTGPNTRRCMCRPGYVGNGLQCLVEAVPPEDRCLESPGPCHPEA
TCTDLHFQEKRAGVFHLQAPEGKYRLTFGEAEKQCLAQGAELASLDQLSAAQQLGFHLCL
TGWLSNGTAAYPAVYPSTSCNTSHAGIILRGTQGSLTERWDAYCYRLRDVTCQCRDGFVG
DGYTVCNGKLLDVLAANANFSTFYGLLLDYANTTQHGLEFLGFLSDELTSKTLFVPINSG
FGNNLTLSWQDLELHASNVTFLSLNLSQGTILPAHSGHQLFISNSSAGNISPFPIQEGTD
VVRVSAVVEWDIIAFNGIIHAIQSPLTAPPKPVSAPLEEQRTATAVAVGTCTALGAGLLL
GLAALYFHHKVKGQGFQFHYFKAEDDEDDFSPWQQGPSPPLISVPNPTFGGHDTFYEPFD
NSFREEEFPDTHRILEEE
Download sequence
Identical sequences F6RL05
13616.ENSMODP00000014275 ENSMODP00000014275 ENSMODP00000014275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]