SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014280 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014280
Domain Number 1 Region: 25-103
Classification Level Classification E-value
Superfamily HR1 repeat 8.11e-21
Family HR1 repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 522-599
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-20
Family PDZ domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014280   Gene: ENSMODG00000011421   Transcript: ENSMODT00000014544
Sequence length 667
Comment pep:novel chromosome:BROADO5:3:438634709:438685391:-1 gene:ENSMODG00000011421 transcript:ENSMODT00000014544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEESPEGEGGGDGGLLSEPPDGGSVQKGCNPLVQTQRSRLQNHRARINQQINKEMRIR
TGAENLFRATTNHRVKETVALELSYVNSNLQLLKEELEELNSSMDVYQNDSEGISVPMIP
LGLKETKDLDLAAPLREMISEHYGEDSASYEVEIKKLTDLRQAIRTPSRNEAGLDLLMEY
YNQLYFLDIRFFSPNKNLGVFFHWYDSLTGVPSHQRTLAFEKGSVLFNIGALYTQIGARR
DRGTRTGIDCAIEAFQRAAGAFNYLKENFSNAPSLDMSMASLSMLVRLMTAQVQECVFEQ
LTLAGTPREPLSQMRLAQEAARVEDVYSLVYQTMAQPPVRDYVPFSWTTMVNVKAKHFRG
LSHYYAAIALCDGPVVADSEISKYEKAFIQFHVTAPEGPSLPVLLQDSEERRKLAKAHLR
KAMMNHEEALRLHAVCRILRKMDLLQEVVSLAHRRSLAKYSEIDHEDDFFETAEAPDVHP
KTHQKPEIKTPSFSQVKVTDIFHRLGPLSVFSAKSQWRLKGPTRLTRGEGGFGFTLRGDS
PVLIAAVIPGGRAEAAGLKEGDYIVSVNGEPCKWGKHSEVVALLTGVGEEGVDIQVVTPL
REESLGLVDKKTATLSSVGLLRSDKENGGQATLPGPLLGWNKKAKRGQGPQRLQPFSLST
DNTPASH
Download sequence
Identical sequences F6RKI8
ENSMODP00000014280 XP_007488902.1.35504 ENSMODP00000014280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]