SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014349 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014349
Domain Number 1 Region: 1-414
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-125
Family L-arabinose binding protein-like 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014349
Domain Number - Region: 444-489
Classification Level Classification E-value
Superfamily TNF receptor-like 0.033
Family TNF receptor-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014349   Gene: ENSMODG00000011479   Transcript: ENSMODT00000014615
Sequence length 782
Comment pep:known chromosome:BROADO5:4:411181914:411205643:1 gene:ENSMODG00000011479 transcript:ENSMODT00000014615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YQQVLALMFAVEEINRDSSLLPNTTLGFHIYNSYHSDARTLESSLRWLSGQGQTIPNYSC
ERQDKSLAVIGGATSALSVQMGTLLELYRFPQVSYGPFDPALSNKVQFPSLYQMAPQDSS
LHLGIVQLLLHFDWTWVGLVVTDDMRGEQFFWLMGEEMRRNKVCVAFTEKIPVSERCHEE
SQVAFMPRIIASSAKVIIVHGDTDSLMILRYSQLHTIPIWKVWVITSHWDVTIRPYSRDG
ETFHGSLIFSHQTSEIPGFGAFLRTVTPAKYPGDIFLKSFWASAFECPDDPAKLEREDCF
LNASLEMLPLHYFDMTMSGLSYLVYNAVYAVAWALHEMFQTRAEMRSVRNEGCLVPQPWQ
LHSSLRNIDFKNTAGDQVVLNEEMNPVAKYDIMNFAMKSNYKEVLVKVGQFVSHSPLVKK
LTHLEDDSAWFCSRGLMEPKEEKAVCTEHCGSGFRKIAQDGEPVCCFDCVPCPEGEISNY
RDMDNCMKCPEDQYPNREKDRCLPKVVTFLNTEEPLGWILTCMALSFSLLTLLILILFIK
HKDTPIVKANNRVLSYTLLISLIFCFLCSLLFIGRPTTVTCLLRQTTFGIIFTVAVSSIL
AKTIMVVLAFKATRPGSRSRIWLKPRVYNFLVLICSMIQVILCGIWLGTSPPFLGTDTHS
EPGHIIIECKEGSVIAFYCVLSYMGILALGSFMVAFLARNLPDTFNEAKFITFSMLVFCS
VWICFLPTYQSSKGKAMVAMEVFAILASSIGLLVCIFIPKCYVILLRPDRNILEGLRNKA
DF
Download sequence
Identical sequences F6VJW2
ENSMODP00000014349 ENSMODP00000014349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]