SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014370 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014370
Domain Number 1 Region: 3-418
Classification Level Classification E-value
Superfamily Cytochrome P450 5.63e-117
Family Cytochrome P450 0.0000000000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014370   Gene: ENSMODG00000011489   Transcript: ENSMODT00000014636
Sequence length 422
Comment pep:novel chromosome:BROADO5:1:10144824:10235314:-1 gene:ENSMODG00000011489 transcript:ENSMODT00000014636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVVVLHGYNIVKEALIDKGDIFMERGNVPIFEDAIKGQGVIFSRGERWKQLRRFSLMT
LRNFGMGKRSIEERVQEEAQCLVEELRKTKGQPNDPTFILGCAPCNVICSILFRDRFKYK
DEKFLYLMSLLNENFQLFTKPWIQLYNFLPAFRVHLPGKHKQLFKNVEELKCFILERVKE
HQEILDPNNPQDYIDCYLSKMQQEKNNPQSEFDVENLIMTGVDLFSAGTETTSSTLRYGL
LLILKHPEVQAKIHEEINRVIGHNRIPSIKDRQDMPYMDAVVHEVQRFIDLLPLNLPHAV
NQDIQLQQYTIPKGTNVFPLLSPVLRDSKEFSNPDKFDPQHFLDKNGSFKKSDCFMPFSA
GKRACLGEGLARMELFLFLTTILQNFTLKPVGDPNEISVKNNHVGFTNVPPYYQLCFLPH
KA
Download sequence
Identical sequences F6V1R8
ENSMODP00000014370 ENSMODP00000014370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]