SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014409 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014409
Domain Number 1 Region: 975-1056
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000129
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 
Domain Number 2 Region: 83-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000191
Family G proteins 0.083
Further Details:      
 
Domain Number 3 Region: 486-614
Classification Level Classification E-value
Superfamily RNI-like 0.0000000122
Family 28-residue LRR 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014409   Gene: ENSMODG00000011523   Transcript: ENSMODT00000014675
Sequence length 1065
Comment pep:novel chromosome:BROADO5:4:353202957:353230225:-1 gene:ENSMODG00000011523 transcript:ENSMODT00000014675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQGNRRKYINRMKEKFSLTWDGSSSSLGNLRDLNKEFVPLMLLHKYKELKNICRKNTPV
SVMTKQAHIIDMSELFGSDERKYVPQTVVLCGGAGIGKTILTRKIMLDWAEGDLFQDRFK
NVIYVNCKTINLTLEMTLVDLISKDWPDLQASIEAIMSNPKQLLFIIDGFDEVKWPFVEP
EPELCHHWKEKCPVPVLLRSLLWKTIFPRSSLLIATRSSALMRFRCLIDDPNCVEVLGFT
EANIEMYISKFFKSEAKVLKVLDLLKVSDTLSEKCSVPLECWIICTCLKQQMERGEVPVL
LPQTTTDLYVSYLSFGLSHDGSSSSQHHDLQLRRLCSLAAEEVWAGKFTFNEDDLKRHGL
DVSDDSFLNMYILEKKDKENCYSFIHGRFLEFFAAMFYVLEEKREERDYPAVAVKDVIEL
LVQTRESDSEVSIMNFLFGLLNEETMRQLDRNFVYPTIQRGKAELLQWMILESNIQRMIN
PLLHPDPLELFQCLYEIRQEELVRKTMKYFQSMRLNLHTSKDILVSIFCIKLCYNLVNIH
LHISRTLMYNSPHILIQWKELISVLLFKKSLIELELSGSFPDDRLMKIVYKEIMHPNCKL
HTLRFHQVELSEEMKKEFENLPKMKNFLKNVEIIPDSEMKEEEYENSPQDHQRFEPEEVT
PQTEAEVTSLLASFDPLKEEQLDLEKCLFLGPNGPVEPEWIDKKRNIYKVRLSMAGFYHC
PYTGLGFDVRSEVTVDIEFGTWNQHLDWIQQQSWMIAGPLFHITVDPGVVTSVHLPHFVH
LQGGKVDISLFKIAHFKEEGMVLENPTRMESSHAILENPSFSPMGVLLRIVHSTFRFIPI
YSTTLIYFRLRAEDITLHLYLIPSDCTIRKAIDEEEAKFHFLRLHKPSPVTPLYIGSRFL
VSGSKHLEIMPTELELCYQSAGECQFFSEIYTSNVKEIISLDLRDPKGTVVWGTLVRSGD
VGTVCAPISPATTELHFVDQHRNQIISRVTSVDIILDRLHSQFLSNEDYEHIRAEKTNPE
KMRRLFSFSPSWSKDYKDHLYRVLREIHPHLMNELEHMEKILVRK
Download sequence
Identical sequences F6RHY5
ENSMODP00000014409 ENSMODP00000014409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]