SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014447 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014447
Domain Number 1 Region: 4889-5103
Classification Level Classification E-value
Superfamily GFP-like 3.98e-63
Family Domain G2 of nidogen-1 0.001
Further Details:      
 
Domain Number 2 Region: 2486-2585
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-25
Family I set domains 0.006
Further Details:      
 
Domain Number 3 Region: 3255-3357
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-24
Family I set domains 0.0034
Further Details:      
 
Domain Number 4 Region: 4092-4188
Classification Level Classification E-value
Superfamily Immunoglobulin 1.65e-24
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 2594-2681
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-24
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 2392-2493
Classification Level Classification E-value
Superfamily Immunoglobulin 6.11e-24
Family I set domains 0.0089
Further Details:      
 
Domain Number 7 Region: 2973-3072
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-23
Family I set domains 0.0039
Further Details:      
 
Domain Number 8 Region: 2311-2399
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 3726-3820
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-23
Family I set domains 0.061
Further Details:      
 
Domain Number 10 Region: 3641-3733
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 2893-2981
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-22
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 1927-2026
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 13 Region: 1181-1276
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-22
Family I set domains 0.0051
Further Details:      
 
Domain Number 14 Region: 1754-1840
Classification Level Classification E-value
Superfamily Immunoglobulin 2.91e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 15 Region: 4000-4100
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-22
Family I set domains 0.031
Further Details:      
 
Domain Number 16 Region: 805-896
Classification Level Classification E-value
Superfamily Immunoglobulin 5.61e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 17 Region: 4375-4463
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 1367-1466
Classification Level Classification E-value
Superfamily Immunoglobulin 6.97e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 19 Region: 3160-3262
Classification Level Classification E-value
Superfamily Immunoglobulin 7.19e-22
Family I set domains 0.0055
Further Details:      
 
Domain Number 20 Region: 1646-1746
Classification Level Classification E-value
Superfamily Immunoglobulin 8.55e-22
Family I set domains 0.005
Further Details:      
 
Domain Number 21 Region: 3080-3167
Classification Level Classification E-value
Superfamily Immunoglobulin 9.7e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 22 Region: 1553-1653
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.0097
Further Details:      
 
Domain Number 23 Region: 1833-1932
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 24 Region: 1462-1560
Classification Level Classification E-value
Superfamily Immunoglobulin 1.23e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 25 Region: 1098-1189
Classification Level Classification E-value
Superfamily Immunoglobulin 1.24e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 26 Region: 4447-4544
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-21
Family I set domains 0.0076
Further Details:      
 
Domain Number 27 Region: 3814-3913
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-21
Family I set domains 0.0057
Further Details:      
 
Domain Number 28 Region: 2802-2885
Classification Level Classification E-value
Superfamily Immunoglobulin 2.84e-21
Family I set domains 0.022
Further Details:      
 
Domain Number 29 Region: 50-225
Classification Level Classification E-value
Superfamily vWA-like 2.89e-21
Family Integrin A (or I) domain 0.026
Further Details:      
 
Domain Number 30 Region: 2692-2782
Classification Level Classification E-value
Superfamily Immunoglobulin 4.03e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 31 Region: 3906-4003
Classification Level Classification E-value
Superfamily Immunoglobulin 4.13e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 32 Region: 526-626
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-21
Family I set domains 0.036
Further Details:      
 
Domain Number 33 Region: 2114-2209
Classification Level Classification E-value
Superfamily Immunoglobulin 9.39e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 34 Region: 613-704
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-20
Family I set domains 0.016
Further Details:      
 
Domain Number 35 Region: 4182-4279
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 36 Region: 2020-2119
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-20
Family I set domains 0.0087
Further Details:      
 
Domain Number 37 Region: 3444-3543
Classification Level Classification E-value
Superfamily Immunoglobulin 3.06e-20
Family I set domains 0.0068
Further Details:      
 
Domain Number 38 Region: 3537-3636
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-20
Family I set domains 0.023
Further Details:      
 
Domain Number 39 Region: 3364-3449
Classification Level Classification E-value
Superfamily Immunoglobulin 4.79e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 40 Region: 2203-2304
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 41 Region: 4267-4365
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 42 Region: 901-995
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 43 Region: 1281-1373
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-19
Family I set domains 0.0061
Further Details:      
 
Domain Number 44 Region: 712-811
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-18
Family I set domains 0.018
Further Details:      
 
Domain Number 45 Region: 993-1086
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-17
Family I set domains 0.0085
Further Details:      
 
Domain Number 46 Region: 5109-5254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.06e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 47 Region: 4713-4771
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000288
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 48 Region: 4599-4657
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000301
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 49 Region: 4656-4714
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000405
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 50 Region: 4544-4600
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000275
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 51 Region: 4828-4885
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00022
Further Details:      
 
Domain Number 52 Region: 4770-4828
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000288
Family TSP-1 type 1 repeat 0.00038
Further Details:      
 
Domain Number 53 Region: 5211-5338
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000518
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 54 Region: 5428-5546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 55 Region: 5333-5378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000244
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 56 Region: 456-530
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000192
Family I set domains 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014447   Gene: ENSMODG00000011458   Transcript: ENSMODT00000014713
Sequence length 5654
Comment pep:novel chromosome:BROADO5:2:81170870:81683100:1 gene:ENSMODG00000011458 transcript:ENSMODT00000014713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISWEIVPCWRVGVHTLLLLALLSSSLAQDASPKKDPGGTEEIPEGASTLAFVFDVTGSM
YDDLVQVIEGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYV
QGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLT
GDCDDRGHIGYKVYEEIASTSSGQIFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEKA
TNTWQIPFDPSLKEVTVSLSGPSPLIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKEP
EPGMWTIKTSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSG
IAVPARVDRLELLSISGGSLKTIPVKYYPDRKPYGIWNISDFIPPNEAFFLKVTGYDKDD
YLFQRVSSVSFSSIVPDAPKVTMPKKTPGYYLQPGYIPCSVESLLPFTLRFVRNGVTLGV
NQYLKESGSVNWDIEKVTLSDEGYYECEATSTAGTGRAETFFDVSEPPPVIQVPNNVTVT
PGEQAILTCIAISAVPYNLTWQRNGRDVKLADPARVSTLTNLSLEINSVKFIDAGEYNCV
VSNEGGSMVASVFLSVQEPPKVTVMPKNQSFTTGSEVSIMCSSTGYPKPKIVWTYNDLFI
MGSHRYRVTSEGTLIIKTAIPKDAGEYGCLASNLAGTDKQISTLRYVGKYKYAPKLTVVQ
SELLVALGDTTIMECQTTGVPSPQVKWFKGDLELRASVFIHIDSQRGILKIQETQDLDAG
DYTCVAVNEAGRATGHITLDVGASPNFIQEPTDVSVEIGSNVTLPCYVQGYPEPKVKWRR
LDNMPLFSRSFAVSSITQLRTGSLSIINLWASDKGTYICEAENQFGKIEAQATITVTGLV
APLIGISPAVANVIEGQQLTLPCILLAGNPIPERRWLKNSAMLVQNPYISVRSDGSLHLE
RVRLQDGGEYTCVATNVVGAHNKTTSVNVYVLPIIQHGQQIFSTIEGVPVSLPCKASGVP
KPSIVWTKKGELITPSNAKFSAGLDGSLYIVSPGGEESGEYVCTATNAAGYAKRKVQLTV
YVRPRVSGDQQGLSQDKPIEISVIAGEDITLPCEVKSLPPPTITWARETQLISPFSPRHI
FLPSGSMKITETRISDSGMYLCVATNIAGNVTQSVKLSVHVPPRIQRGPRLLKVQVGQRV
DIPCNAQGLPLPALTWFKNGNTMVIDGEQYTSSPDGTLSIAQVHLSDSGVYKCVANNIAG
SDEAEITVQVQEPPAIEDLDPPYNTPFQERVANQRIAFPCPVKGTPKPTIKWLRNGRELT
GREPGLSILEEGALLVIASVTPYDNGEYICVATNEAGTTERKYNLKVHVPPEIRDKGHVT
NVSVVLNQPTNLFCEVSGNPSPIIMWYRDDVQVTESSTVQITHNGKMLQLFKASPEDAGR
YFCRAINIAGSSEKDFNVAVLIPPTIIGANFPSEVSVILNHDTSLECQVKGTPFPAIQWF
KDGKPIFLGDPNIELLDRGQVLYLKNVRRNDKGRYQCSVSNAAGKQNKDIKLTVYVPPSI
KGSNVTTEVSALINSIIKLECEARGLPVPVITWHKDGQLIISSPQALYIDKGHFLQISHA
QVSDSGKYTCHVTNIAGTAEKTYEVDVYVPPVIEGNSETPLNRQVIIGNSLTLECKAAGN
PPPVLTWLKDGAPVKASDNIHIVAGGKKLEIMNVLEADHGQYVCVANSVAGEKEIKYNVD
VLVPPNVEGGDETSDFIVIVNNLLELDCQVMGSPPPTIMWLKDGQPIEEEDGFKILLNGR
KLVITQAQVSDTGRYQCVATNTAGTHEKEFDVTVHVSPTIKSTGPSERSVVIYKPVTLQC
IANGIPNPSITWLKDGQPVNTARGNIKLQSSGRILQIAKALLEDAARYTCVATNAAGEAQ
QHIRLHVHEPPHLENAGKMLNETVVINNPVQLECEASGNPLPAITWYKDNHPLSSSAGAT
FLKRGQILEIDNAQIADTGIYKCVAINMAGTAELFYSLQVHVPPSISGSNDMISVVVNNL
VRLECEARGIPAPSLTWLKDGSPVSSFSDGIQVLFGGRILALTSAQISDTGKYTCVAVNA
AGEKQRDIDLRVYVPPNIMGEEQNVSAFINQVVELHCQGNAIPPPILTWLKDGRPLLKKP
GLSVSENGSILKIEGAQVQDTGRYTCEATNVAGKTEKNYNVNIWVPPNIHGSDELTQLTV
IEGSLISLVCESSGIPPPSLIWKKKGSPMLTDSTGRVRMLSGGRQLQISIAERSDTGLYT
CIASNVAGNAEKKYNLQVYTRPTISSNSNHPAEIIVTRGKSITLECEVQGIPKPSVTWMK
DGRPLLPGRGVEILNEGHLLQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHVPPSIVG
DQEVPENISVVEKNPVTLTCEASGIPLPSITWLKDGWPITLTSSMRILSGGRMLRMMQAR
VEDAGQYTCIVRNAAGEKRRIFGLSVLVPPSIVGENTLEDVKVKEKLGVTLTCEATGNPV
PQITWLKDGQHLIEDGDHQIMSSGRFLQITNAQVSDTGRYTCVASNTAGDKSKSFSLNVF
VSPTIAGVDNDGSPEDVTVILNSPTSLVCEAYSYPPATITWFKNGAPIESNQNIRILPGG
RTLQILNAQEDHAGRYSCVATNEAGEMVKHYEVKVYIPPIINRGDLLGQGLSPKEVKIKV
NNSLTLECEAYAIPAPALSWYKDGQAKPLKSDDHVNIAVNGRTLQIKEAQVSDTGRYTCV
ASNIAGEDELEFDVNIQVPPSFKKLWEIGNMLDIGRSGEAKDVIINNPISLYCETNAVPP
PTLTWFKDGFPLTSSDKVLILPGGRVLQIPRAQIEDAGRYTCVAVNEAGEDSLQYDIRVL
LPPSIKGADIDLPEEVTVLVNKTALMECVSSGSPVPSNFWQKDGQPLVEDDRHKFLSNKR
TLQILNSQIADIGRYVCVAENVAGSTKKYFNLNVHVPPSIIGTNPENLTVVVNNFISLAC
EATGFPPPDLSWLKNGKSINLSNNVLIVPGGRSLQIIRAKISDGGEYTCIAMNHAGESKK
KISLTVYVPPSIKDHGSESLSVINVREGSPVSLECESNAVPPPVITWYKNGRMIMESANL
GVLGDGQMLNIKAAEVSDTGQYVCRAINVAGQDDKNFHLNVYVPPKIEGPQEEKVVETIS
NPVTLACDATGIPPPTLVWMKNRKPIENSDSLEVHVLSGGSKLQIARSQHSDSGTYTCIA
SNVEGKAQKNYLLSIQVPPSIIGSEMPSEVSVLLGENVHLICNANGTPRPVIQWLKDGKP
LRSGEIERIRVTPDGSTLNIFGALTSDMGKYTCVATNPAGEEDRIFNLNVYVSPSIVGNK
EETEKLMALLDTSINIECTATGIPPPQINWLKNGLPLPISSQIRLLSAGQVIRIVRAQVS
DVGLYTCVASNRAGVDNKHYSLQVFVPPSMDNAAGTEEITIIKGSPTSLTCFTDGIPTPT
MSWLKDGQPLELVSHLKMNNQGMVLQFVEAETQDSGKYTCVASNEAGEVKKHFVLKVLEP
PHINGSDHPEEISVVVNNLLELFCMASGIPTPQITWMKDGRPLPQIDDVQILGGGEVLRL
PSAQVEDTGRYTCLASSPAGDDDREYLVRVHVPPNIAGTSDLQDITVLQNRQVTLECKSD
AVPPPVITWLKNGERLQATPRIRILSGGRYLQINNADLGDTASYTCVASNIAGKTTREFV
LTVNVSPTIKGGPQSLIVHVNKSAVLECIVEGVPTPRITWRKDGAILTGNNARYSVSENG
FLHIHSAHVSDTGRYLCMATNAAGTERKRIDLQVHVPPSVAPGSTNITVTVNVQTTLACE
ATGIPRPSITWKKNGQFLNVDQNQNSYRLLSSGSLVIISPTVDDTAIYECMVSNDAGEDQ
RTISLNVQVPPSIADETTDLLVTKLSPVVITCTTSGVPPPSIHWTKNGIRLLPRGDGYRI
LSSGAIEITAAKLDHAGKYTCVARNAAGSAHRRVTLHVQEPPIIQSQPSNLDVILNNPIL
LPCEATGTPSPVITWQKEGINIITSGISHKSYTVLPNGGLQITKAVIDDAGTYMCVAQNP
AGTALGKIKLKVQVPPVIHSHPKEYVISVDKPVTLLCEAEGYPPPDITWHKDGHEVTESV
RQRILSSGALQIAFAQTDDAGQYTCMAANVAGSQSSSTSLIVHVPPRIRTTEVQYTVNEN
SQAILPCVADGIPTPAINWKKDNILLTDLLGKYTAEPYGELILENAVPEDSGSYTCIANN
AAGEDTHTVSLTVYVLPTFTELPGDISLNKGDELRLSCRATGLPLPRLTWTFNNNIIPAQ
FDSVNGHSELVIERVSKDDSGTYVCTAENKVGFVKAIGFVYVKEPPVFKGDYHSNWIEPL
GGNVILNCEVKGDPPPTIQWSRSGVGVQISNRIRQLSNGSLAIYGTVNEDAGDYKCIATN
DAGVVERSMTLTLQSPPVITLEPMETITTAGSTIVLNCQAIGEPPPTIEWSRQGRPLLWD
DRVTLLSNNSLRISMAQKEDTSDYECVARNLMGSVLVRVPVTVQVHGGYSEWFEWRPCSV
TCGQGVQKRIRQCNNPFPANGGKPCQGPDSEMRNCQNKPCPVDGNWSEWSPWEECTRTCG
QGNRTRTRTCNNPPAQHNGKPCEGNAVDIFMCNAKPCPVRGAWSTWLPWGSCSESCGKGT
QTRMRLCNNPPPSFDGAYCDGAETQMQVCNERPCPVDGKWASWASWSACSVSCGGGSRQR
TRDCSNPAPQHGGHKCEGNDVQIDFCNSDPCPTHGSWSPWSGWGTCSRTCNGGQMRRYRT
CDSPRPANGGRACAGADSQIQRCNIDMCPVDGNWGNWHTWSRCSTSCGGGEKTRKRICNN
PAPSKSGRPCPGDATQVSRCNIQTCPGSGPQQARGSVIGNINDVEFGIAFLNATVIDSPH
SDTRVIQAKITNVPRSLGPAMRKIVSILNPIYWTTAKEIGEAVNGYTLTNAVFKRETQVE
FATGEILRMTHIARGLDSDGTLMLDIVVSGYVLQLQSPADVTVKDYTEDYIQTGPGQLYA
YSTRLFTVDGVSVPYTWNHTISYDQTLGRMPFLVETLHASSIASDYNQLEETLGFKIHAS
ISKGDRSNQCPSGFVLDSAGPFCADEDECAARNPCSHSCHNAMGTYYCSCPKGLTIAADG
RTCQDIDECALGGYSCHAGQDCDNTIGSYRCVVRCGTGFRRTTDGLSCQDINECQESNSC
HQRCFNTIGSFHCGCEPGYQLKGRKCMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGM
TKAENGTCIDIDECKDGTHQCRYNQICENTRGSYRCVCPRGYRSQGVGRPCMADINECEQ
VPKPCAHQCTNIPGSFKCICPPGQHLLGDGKSCAGLERLPNYGARYSSYNLAQYSPLRDN
NQPQQHYRQYSNRYSSYSEYRNSRTSISRTKRNIRKTCPEGCEARNHTCIDIDECENRDS
CQHECKNTFGSYQCICPPGYQLMPNGKTCQDIDECLEENIHCGPNRMCFNMRGSYQCIDT
PCPPNYQREPVSGFCLKNCPPNDLECALSPYALEYKLVSLPFGIAANQDLIRLVAYTQDG
VMHPRTTFLMVDEDQTVPFALRDENLKGVVYTTRPLREAETYRMRVRALSYSADRTIEYQ
TTFIVYIAVSAYPY
Download sequence
Identical sequences F6QWR8
ENSMODP00000014447 ENSMODP00000014447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]