SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014470 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014470
Domain Number 1 Region: 340-416
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000000133
Family Intermediate filament protein, coiled coil region 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014470
Domain Number - Region: 114-142
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000152
Family Intermediate filament protein, coiled coil region 0.0059
Further Details:      
 
Domain Number - Region: 118-214
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014470   Gene: ENSMODG00000011564   Transcript: ENSMODT00000014737
Sequence length 420
Comment pep:novel chromosome:BROADO5:8:271834757:271900873:-1 gene:ENSMODG00000011564 transcript:ENSMODT00000014737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GDERRDSQYPAGVSASMPFPRRRSSFLGSHSSSSLDSPGASGHRVSVVGNSMGGLPRPPG
VYVGAVPTGGVSSLGTRVSRRALGISSVFLQGLRSSSTALALSPGLEKNRGIFFESLNGC
MVEYIEKVRALEQVNRELEEHLRVYLEKKASSISNWGALRETWESVYHQVGDAVLDNARL
MLQTENTQACAEDFKERYENEQPFRKAAEDEINSLYKVIDDANLTKMDLESQIESMKEEL
AFLSRNHEEDVKMLYKQLAGSELEGMDAPIGTGLDDILETIRIHWEKDIEKNRAETGALL
YAKQQSQVVQAARSQEEDLVEALRAEFHDTACDIQRLQAETESLRTLKRGLENSLYDAKH
WHDIELQNLGSVIAKLEAELGEIQRETEQQQKDREHLLSGKLQLEKDIVSYHCLLDREGS
Download sequence
Identical sequences F6QBM9
ENSMODP00000014470 ENSMODP00000014470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]