SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014473 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014473
Domain Number 1 Region: 36-219,286-362
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.84e-64
Family Crotonase-like 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014473   Gene: ENSMODG00000011566   Transcript: ENSMODT00000014740
Sequence length 386
Comment pep:novel chromosome:BROADO5:4:207200746:207321005:-1 gene:ENSMODG00000011566 transcript:ENSMODT00000014740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSEVLRPVSRFNSFKRTQIILQHLRMSSHTDSEPEVLLERKGCAGVITLNRPKALNSL
NISMIRQIYLQLKKWEEEPETSLIIMKGAGGKAFCAGGDVKAIAEAGKAKEKWIQDFFKE
EYTLNRAIGTYQKPYVSFIHGITMGGGVGVSVHGDFRVATEKTLFAMPETALGLFPDVGG
GYFLPRLPGKLGYFLGLTGFRLKGRDVQKGGVATHFVDSDKLTMLEEDLLALKSPSKENV
AEVLDSYHKKCEVNQDKPFVLEEHMNNINSWFSASTVEQIIKHLEDDGSPFALEQLKIMK
KMSPASLKISLRQLIEGSSKNLTEVLIMEYRLSQACLRGHDFYEGVRAILVDKDQNPKWK
PAKLEEVTDEFVNECFKSLGSNDLKF
Download sequence
Identical sequences F6QBJ8
XP_007494569.1.35504 ENSMODP00000014473 ENSMODP00000014473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]