SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014525 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014525
Domain Number 1 Region: 272-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-44
Family SPRY domain 0.00029
Further Details:      
 
Domain Number 2 Region: 87-149
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000119
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 6-61
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000099
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014525   Gene: ENSMODG00000011608   Transcript: ENSMODT00000014793
Sequence length 467
Comment pep:novel chromosome:BROADO5:4:353528928:353537955:-1 gene:ENSMODG00000011608 transcript:ENSMODT00000014793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPVTLVQSLQQETTCGICLTFFTKPVTLNCGHNFCQFCLSRSREAGVTHFSCPECREVC
QSFPGLNVRLSKLAAICKKLSAQNLQNPVGQRCCQEHQQVPKVFCKEDQTTLCLTCTEAQ
EHETHTLSPIDEAAQNFREKLLDTMPSLRKKIKELKELNVSKKDREVKWRKLIRGEYARM
HQFLKEEEHRCLDVVTNDEAMTNQLMDSYYNELHQHFKNMEDTVREMEETKRRPDLELLQ
EGKELLQTCESMLSERPKSFIPELREYPVVGMKDMLKKFRVNVTMDPTTVNPYFVLSENL
KSVKLKNNSLDQPDCAGKVQHFILGQPAFSSGAYYWEVDVSEQPQWALGISVKCLKKRKT
IQYTAGYLYMLRCEKRGNEFYLVTRPGLVCQLMKVPVPVVGIYLDCNDRTLLFYNATKAS
LIYEMHIMPFKEPVRPLFCPCPPMLGTKIGSMTICPVKCNICGNACL
Download sequence
Identical sequences F6UHI9
ENSMODP00000014525 ENSMODP00000014525 XP_016277542.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]