SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014557 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014557
Domain Number 1 Region: 189-517
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-65
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 10-95
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000518
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014557   Gene: ENSMODG00000011627   Transcript: ENSMODT00000014825
Sequence length 717
Comment pep:novel chromosome:BROADO5:X:14510870:14527854:-1 gene:ENSMODG00000011627 transcript:ENSMODT00000014825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGAAPGGPGDPASQRFLYEVPAWVMCRFYQVMDSLESADWHKFASLIVQDQTELRLGE
RFHDRTARIMWSWINRNARVADLLHILTSLQLRDPEPPSLPPAAPSTCTPTPPWPPPQPK
PQSGPKEEGARPREACQSFSTFPSPGFPSDSWPSPCPPSSPAPQRAAGPLSSNTSSSSTK
QGEENKISPVEYASPPPFRWPLLEITQATHNFSEELKIGEGGFGCVYRAVMRNTSYAVKR
LKEDAELEWNTIKTSFGTEVEKLSRFRHPNIVDFAGYCIQDNVYCLVYVFLPNGSLEDQL
HSQNQNPSLLSWAQRVDILLGTARAIQFLHQDNPSLIHGDVKSSNILLDEKLVPKLGDFG
LARFSRYSGAASGKSSSLARTQTVRGTLAYLPEEYVKTGKLTVEIDTFSFGVVLLEILTG
CRAIETDGARTKYLKDLVEEEEEETLASCKGMATGAGVDLEARAAQIGSRLYAKYTDSRP
GKCPPELGQELGRLACRCLHRRGKRRPPMTKIYESLEKLQASVGPSEREAGSRGPASPQE
DSYMFTPNSAPDGGTPLLHSQARAWHRQPPHSSHGSRAQDSKQLWNHPNQPVESDESTPG
LCDVLNSWNLNQNSPSALCSLRQTSCQPEAAASGESWGSQTKTGSLGHGQNSSEESDTSE
RPQIIINPARQRFVQKLALYENGVLNSLELLSSSSSPGLGLDQGNKQGPEESDEYQS
Download sequence
Identical sequences F6U139
ENSMODP00000014557 ENSMODP00000014557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]