SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014573
Domain Number 1 Region: 11-112,140-253
Classification Level Classification E-value
Superfamily Translational machinery components 3.14e-68
Family Ribosomal protein L18 and S11 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014573   Gene: ENSMODG00000011635   Transcript: ENSMODT00000014841
Sequence length 297
Comment pep:novel chromosome:BROADO5:2:11537422:11551246:-1 gene:ENSMODG00000011635 transcript:ENSMODT00000014841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDI
ICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGLLLARRLLNRFGMDKIYE
GQVEVTGDEYNVESIDGQPGAFTCYLDAGLARTTTGNKVFGALKGAVDGGLSIPHSTKRF
PGYDSESKEFNAEVHRKHIMGQNVADYMRYLMEEDEDAYKKQFSQYIKNNITPDMMEEMY
KKAHAGIRENPVYEKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAADS
Download sequence
Identical sequences F6TJU3
ENSMODP00000014573 ENSMODP00000014573 XP_007480367.1.35504 XP_020831051.1.61212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]