SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014634 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014634
Domain Number 1 Region: 64-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.26e-107
Family alpha-D-glucuronidase/Hyaluronidase catalytic domain 0.00000553
Further Details:      
 
Domain Number 2 Region: 720-917
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000361
Family N-acetyl transferase, NAT 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014634   Gene: ENSMODG00000011681   Transcript: ENSMODT00000014904
Sequence length 919
Comment pep:novel chromosome:BROADO5:1:110385557:110412299:1 gene:ENSMODG00000011681 transcript:ENSMODT00000014904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQKENQAALEERESELTPNPAATAATPGGPLEPAAAPSPGEGSQAGAGGGTAAAAASGG
ARRFLCGVVEGFYGRPWVMEQRKELFRRLQKWELNTYLYAPKDDYKHRMFWREMYSVEEA
EQLMTLISAAQEYEIEFIYAISPGLDITFSNPKEVSTLKRKLDQVSQFGCRSFALLFDDI
DHNMCAADKEVFSSFAHAQVSITNEIYQYLGEPETFLFCPTEYCGTFCYPNVSQSPYLRT
VGEKLLPGIDVLWTGPKVVSKDIPVESIEEVSKIIKRAPVIWDNIHANDYDQKRLFLGPY
KGRSTELIPRLKGVLTNPNCEFEANYVAIHTLATWYKSNMNGVRKDVVMTDSEDSTVSIQ
IKLENEGSDEDIETDVLYSPQMALKLALTEWLQEFGVPHQYSSRQVAHSGAKASVVDGAP
LVAAPSLSATTVVTTVYQEPIMSQGTTLSNEPPALVKEEEKKQMDEEPMDMVVEKQEETD
KNDNQILTEIVEAKMAEELKPMDTDKESIAESKSPEMSMQEDCISDVAPMQTDEQTNKEQ
FVPGPNEKPLYTAEPVTLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRANSSVVSVNCK
GKDSEKIEEWRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSF
VQWLGCRSQSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDLFFQPPPLTPTSKVYTI
RPYFPKDEASVYKICREMYDDGVGLPFQSQPDLIGDKLVGGLLSLSLDYCFVLEDEDGIC
GYALGTVDVTPFIKKCKISWIPFMQEKYTKPNGDKELSEAEKIMLSFHEEQEVLPETFLA
NFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCF
EIAKMEGFPKDVVILGRSL
Download sequence
Identical sequences F7GE71
XP_001369677.1.35504 ENSMODP00000014634 ENSMODP00000014634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]