SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014655 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014655
Domain Number 1 Region: 105-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000126
Family EGF-type module 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014655   Gene: ENSMODG00000011701   Transcript: ENSMODT00000014926
Sequence length 208
Comment pep:novel chromosome:BROADO5:1:331989793:332008624:-1 gene:ENSMODG00000011701 transcript:ENSMODT00000014926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLPSFVLQLLLAAVFSALVSGESLERARSRLSENWGTENPDSLTGSSNQLLHPQASRTE
VLDLQDTEHDLVRVAFSTKPQALVTPSKEENGKKRRKGKGMGRKRDPCLRKYKDYCIHGA
CKYVKVLRKPSCICQTGYHGERCHGLTLPVENPLYGYDHTTILAVVAVVLSSVCLLIIAG
LLMFRYQKRGVYDVESEEKVKLGTPGAH
Download sequence
Identical sequences F7G3R4
ENSMODP00000014655 ENSMODP00000014655 13616.ENSMODP00000014655 XP_016284048.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]