SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014688 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014688
Domain Number 1 Region: 63-572
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2e-192
Family Myeloperoxidase-like 0.0000000000000209
Further Details:      
 
Domain Number 2 Region: 23-60
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family EGF-type module 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014688   Gene: ENSMODG00000011721   Transcript: ENSMODT00000014959
Sequence length 608
Comment pep:novel chromosome:BROADO5:2:82223934:82234062:-1 gene:ENSMODG00000011721 transcript:ENSMODT00000014959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKRISRLLLFGSIALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENCTT
PEFLTKLKLMLKPTPDTVHYILTHFKGVWNIINNIPFLRDFVMRYVLISRAHLIESPPTY
NAHYGYKSWEAFSNLSYYTRALPPVGDDCPTPLGVKGKKQLPTSKEIVEKFLLRRKFIPD
PQGTNMMFAFFAQHFTHQFFKTDHHRGPEFTKGLGHGVDLNNVYGETLDRQHKLRLFKDG
KLKYQVIDGEVYPPLVKDTEVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIYLREHN
RVCDILKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQ
FQYQNRIAAEFNTLYHWHPLLPDTFQIKDQEYNFQQFLYNNSILLKHGVSEMVESFSKQI
AGRVAGGKNVPSAVQKVSIASIDQSRQMKYQPLNEYRKRFMLKPFSSFEELTGEKEMAAE
LEAVYGDIDAMELYPALLVEKPRPGAIFGETLVELGAPFSLKGLMGNPICSPEYWKPSTF
GGNVGFEIIKTASIQSLICNNVKGCPFTAFSVQDSQPTKTATINASSSNSGLDDINPTVL
LKERSTEL
Download sequence
Identical sequences F7FSX5
ENSMODP00000014688 ENSMODP00000014688 XP_001375945.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]