SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014699 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014699
Domain Number 1 Region: 146-276
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-45
Family Galectin (animal S-lectin) 0.000000686
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014699   Gene: ENSMODG00000011734   Transcript: ENSMODT00000014970
Sequence length 281
Comment pep:novel chromosome:BROADO5:1:277019692:277045761:1 gene:ENSMODG00000011734 transcript:ENSMODT00000014970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGFSLNDALSGSGNPNPQGWPQGPWGNQPPGAGAYPGYPGAQPGPGAPGAYPGPGAPG
AYPGPGAPGAYPGPGAPGAYPGPGAPGAYPGPGAPGAYPGPAAPGAYPGPAAPGAYPAPG
QPSAPGVYPPSGPTGTPSGPMGGPLVVPYDHPLPGGIMPRMLITILGTTKPNANKIALDF
KKGNDVAFHFNPRFNEDNRRVIVCNSKFDNNWGKEERHHMFPFEAGKPFKIQVLVETDHF
KVAVNDAHLLQYNHRMKNLNEITKLGISGDVNLTSTSQTMI
Download sequence
Identical sequences F7FSR7
XP_007473215.1.35504 XP_007473216.1.35504 ENSMODP00000014699 ENSMODP00000014699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]