SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014736 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014736
Domain Number 1 Region: 316-565
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.24e-98
Family STAT DNA-binding domain 0.0000000285
Further Details:      
 
Domain Number 2 Region: 135-316
Classification Level Classification E-value
Superfamily STAT 3.92e-59
Family STAT 0.00000859
Further Details:      
 
Domain Number 3 Region: 566-702
Classification Level Classification E-value
Superfamily SH2 domain 2.56e-43
Family SH2 domain 0.00000411
Further Details:      
 
Domain Number 4 Region: 1-121
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 5.36e-43
Family Transcription factor STAT-4 N-domain 0.000000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014736   Gene: ENSMODG00000011767   Transcript: ENSMODT00000015008
Sequence length 749
Comment pep:novel chromosome:BROADO5:4:208271882:208402301:-1 gene:ENSMODG00000011767 transcript:ENSMODT00000015008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWNQVQQLEIKFLEQVDQFYDDTFPMEVRHLLAQWIEGQDWEAASNNETMATILLQNL
LLQLDEQLGRVAQEKNLLLIHNLKRIRKLLQGKYHGNPMHIAVVISNCLREERRILAAAS
MPVQGPLEKSLQSSVVSERQRNVEHKVAAIKNSVQMTEQDAKYLEDLQDEFDYRYKTIQT
IDQGDKNSVLVKQEVMTLQDMLNTLDFKRKEVLSKITQIISEIDTLMNTMLLEELLDWKR
RQQIACIGGPLHSGLDQLQNCFTLLAESLFQVRRQLEKLDEQSTKVSYEGDPIPLQRSHL
QERVNFLIYNLFRNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQIKVK
ATIDKNVSTVSNRRFILCGTHVKAMNMEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGPH
MVTEELHSISFETQICLYGLTIDLETNSLPVVMISNVSQLPNAWASIIWYNLSTNDSQNL
VFFNNPPTAALSQLLEVLSWQFSSYVGRGLNSDQLNMLAEKLTASQASYSDGQLSWAKFC
KEHLPGKAFTFWVWLEAILDLIKKHILPLWIDGYIMGFVSKEKERVLLKDKMPGTFLLRF
SESNLGGITFTWVDQSENGEVRFHSVEPYNKGRLAALPFADILRDYKVIMAENVPENPLK
YLYPDIPKDKAFGKHYSSQPNEVSRPTERGDKGYVPSVFIPISTIRSDSTEPRSPSDLLP
MSPSVYAVLREHLSPTVIETAMSSPYSAD
Download sequence
Identical sequences F7CW94
XP_003341336.1.35504 XP_007494596.1.35504 13616.ENSMODP00000014736 ENSMODP00000014736 ENSMODP00000014736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]