SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014966 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014966
Domain Number 1 Region: 129-457
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-83
Family Protein kinases, catalytic subunit 0.00000225
Further Details:      
 
Domain Number 2 Region: 1017-1085
Classification Level Classification E-value
Superfamily G protein-binding domain 6.8e-25
Family RhoA-binding domain 0.0000685
Further Details:      
 
Domain Number 3 Region: 1190-1279,1356-1390
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000101
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 4 Region: 1298-1347
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000419
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000014966
Domain Number - Region: 591-696
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0484
Family Myosin rod fragments 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014966   Gene: ENSMODG00000011938   Transcript: ENSMODT00000015241
Sequence length 1427
Comment pep:novel chromosome:BROADO5:1:560495912:560675567:-1 gene:ENSMODG00000011938 transcript:ENSMODT00000015241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGGAGRDGEGPGAGGSGSPPAPRERGPERDEPGIVSGGSRMSQPRVEKMSGAPETEPWNW
AFASRQRQLEAMIRDPRSPIYVESLLDGLNSLVLDLDFPALRKNKNIDNFLIRYEKIVTK
IRCLQMKAEDFDVVKVIGRGAFGEVQLVRHKASQNVYAMKLLSKFEMIKRSDSAFFWEER
DIMAFANSPWVVQLFCAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLA
LDAIHSMGLIHRDVKPDNMLLDKNGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEV
LKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKIMDHKNSLNFPEDAEI
SKHAKNLICAFLTDREVRLGRNGVEEIKQHSFFKSDQWNWDNIRETAAPVVPELSSDIDS
SNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSSSSCTENDSVQSRKNE
QSVQIQKKLFLLEEHLNNEIQAKEDLDQKCKLVSTRLEKITKELEEEVTSRKNVESTLRQ
LEREKALLQHKNTEYQRKAEYEADKKRNLENDVNSLKDQLEDLKKRNQNSQISNEKVNQL
QRQLDEANALLRTESDTAARLRKNQTESSKQIQQLECNNRELQDKNCMLENAKLKLEKDF
INLQSALESERRDKTHGSEIINDLQGRISGLEEDIKNGKISLTKMELEKRQLQERFTDLE
KEKSNMEIDMTYKLKVIQQSLEQEEAEHKTTKARLADKNKIYESIEEAKSEAMKEMEKKL
LEERTLKQKVENLLLEAEKRCSMLDCDLKQSQQKVNELLKQKDKLNEDVRNLTLKIEQET
QKRCLTQNDLKMQTQQVNTLKMSEKQMKQENNHLMEIKMSLEKQNIELRKERQDADGQMK
ELQDQLEAEQYFSTLYKTQVRELKEECQEKTKLCKEMQQKNQELQDERDSLAAQLEITLT
KADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELVEKDATIASLEEANRTLTS
DVANLANEKEELNNKVKEVQEQISRLKDEETNISVIKSQFEKQLLNERTLKTQAVNKLAE
IMNRKEPPKRGADTDVRRKEKENRKLHMELKSEREKLTQQMIKYQKELNEMQAQIAEESQ
IRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPGEAEADDGFPESRLEGWLSLP
VRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLFHVRPVTQTDVYRAD
SKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNCICHKGHEFIPTLYHFPTNCEACMKP
LWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISSAKNLLLLANSTEDQQKW
VSRLVKKIPKKPPAPDPFARSSPRTSMKVQPNQSIRRPSRQLPPSKP
Download sequence
Identical sequences F7DDX8
ENSMODP00000014966 ENSMODP00000014966 13616.ENSMODP00000014966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]