SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015028 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015028
Domain Number 1 Region: 127-392
Classification Level Classification E-value
Superfamily vWA-like 6e-88
Family Trunk domain of Sec23/24 0.00000129
Further Details:      
 
Domain Number 2 Region: 8-66,409-517
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 1.16e-65
Family beta-sandwich domain of Sec23/24 0.00028
Further Details:      
 
Domain Number 3 Region: 621-761
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.17e-56
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000511
Further Details:      
 
Domain Number 4 Region: 518-620
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 7.59e-48
Family Helical domain of Sec23/24 0.00000722
Further Details:      
 
Domain Number 5 Region: 49-121
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 5.1e-21
Family Zn-finger domain of Sec23/24 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015028   Gene: ENSMODG00000011994   Transcript: ENSMODT00000015304
Sequence length 765
Comment pep:novel chromosome:BROADO5:1:278412763:278495586:1 gene:ENSMODG00000011994 transcript:ENSMODT00000015304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFLEFIQQNEDRDGVRFSWNVWPSSRLEATRMVVPVASLFTPLKERPDLPPIQYEPVL
CSRSTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPTYAGISELNQPAELLPQFSSIEYV
VLRGPQMPLIFLYVVDTCMEDEDLQALKESMQMSLSLLPSTALVGLITFGRMVQVHELGC
EGISKSYVFRGTKDLTAKQLQEMLGLSKVPVTQAARGPQVQQPPPSNRFLQPVQKIDMNL
TDLLGELQRDPWPVPQGKRPLRSSGVALSIAVGLLECTFPNTGARIMMFIGGPATQGPGM
VVGDELKTPIRSWHDIEKDNAKYVKKGTKHFEALANRAATTGHVIDIYACALDQTGLLEM
KCCPNLTGGYMVMGDSFNTSLFKQTFQRVFTKDMQGQFKMGFGGTLEIKTSREIKISGAI
GPCVSLNSKGPCVSENEIGTGGTCQWKICGLSPNTTLALYFEVVNQHNAPIPQGGRGAIQ
FVTQYQHSSGQRRIRVTTVARNWADAQTQIQNIAASFDQEAAAILMARLAVYRAETEEGP
DVLRWLDRQLIRLCQKFGEYHKDDPSSFRFSETFSLYPQFMFHLRRSPFLQVFNNSPDES
SYYRHHFMRQDLTQSLIMIQPILYAYSFSGPPEPVLLDSSSILADRILLMDTFFQILIYH
GETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLS
KVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA
Download sequence
Identical sequences F7B980
ENSMODP00000015028 ENSMODP00000015028 13616.ENSMODP00000015028 XP_007473242.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]