SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015171 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015171
Domain Number 1 Region: 9-139
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 4.03e-113
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00000327
Further Details:      
 
Domain Number 2 Region: 277-420
Classification Level Classification E-value
Superfamily L30e-like 1.46e-56
Family ERF1/Dom34 C-terminal domain-like 0.000000259
Further Details:      
 
Domain Number 3 Region: 145-250
Classification Level Classification E-value
Superfamily Translational machinery components 2.99e-50
Family ERF1/Dom34 middle domain-like 0.00000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015171   Gene: ENSMODG00000012115   Transcript: ENSMODT00000015453
Sequence length 437
Comment pep:novel chromosome:BROADO5:1:329522355:329559794:-1 gene:ENSMODG00000012115 transcript:ENSMODT00000015453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDPSAADRNVEIWKIKKLIKSLEAARGNGTSMISLIIPPKDQISRVAKMLADEFGTAS
NIKSRVNRLSVLGAITSVQQRLKLYNKVPPNGLVVYCGTIVTEEGKEKKVNIDFEPFKPI
NTSLYLCDNKFHTEALTALLSDDSKFGFIVIDGSGALFGTLQGNTREVLHKFTVDLPKKH
GRGGQSALRFARLRMEKRHNYVRKVAETAVQLFISGDKVNVAGLVLAGSADFKTELSQSD
MFDQRLQSKVLKLVDISYGGENGFNQAIELSTEVLSNVKFIQEKKLIGRYFDEISQDTGK
YCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDK
ETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQ
GMEYQGGDDEFFDLDDY
Download sequence
Identical sequences A0A0B8RQS0 A0A0P6J1U6 A0A1L1RX26 A0A1S3FIW8 A0A1U7Q700 A0A1U7T3H9 A0A1W7RHI3 A0A218UC43 A0A250YI86 A0A2I3LZP2 A0A2K5D3K0 A0A2K6FNC0 A0A2K6RGE5 E2RBM3 F2Z505 F7CTK0 F7FU88 G3TH63 H0UYD7 H2PGP3 I3NEJ2 J3S4U3 K7BB92 K9IJW5 L5JUS2 M3WU44 M3YD56 P62495 P62496 P62497 Q0VCX5 Q5U2Q7 Q8BWY3 T1E4T3 U3FBV5 U3FM72
ENSPTRP00000029564 ENSPPYP00000017698 ENSSSCP00000015251 ENSOCUP00000005745 ENSSSCP00000015251 ENSPVAP00000007888 ENSMUSP00000025218 ENSSTOP00000022789 ENSCPOP00000002146 ENSMODP00000015171 ENSSTOP00000022789 ENSP00000353741 ENSBTAP00000035133 ENSCPOP00000002146 ENSP00000353741 ENSMPUP00000009263 ENSOCUP00000005745 ENSOPRP00000015008 ENSFCAP00000017881 NP_001008345.1.100692 NP_001008345.1.4139 NP_001069722.1.59421 NP_001069722.1.76553 NP_001076236.1.1745 NP_001253403.1.72884 NP_001268599.1.91757 NP_004721.1.87134 NP_004721.1.92137 NP_659115.3.92730 XP_001171542.1.37143 XP_001368222.1.35504 XP_002744252.1.60252 XP_003124023.1.46622 XP_003404572.1.64505 XP_003477446.1.53824 XP_003829267.1.60992 XP_003933986.1.74449 XP_003980859.1.62641 XP_004282110.1.21590 XP_004381103.1.4749 XP_004397883.1.74151 XP_004420187.1.5094 XP_004467078.1.11602 XP_004586511.1.84141 XP_004609961.1.94378 XP_004643309.1.9945 XP_004686833.1.23501 XP_004744918.1.14098 XP_005209480.1.76553 XP_005312449.1.60341 XP_005327314.1.77405 XP_005355984.1.66349 XP_005382154.1.28644 XP_005532621.1.90289 XP_005557970.1.63531 XP_005626484.1.84170 XP_005968138.1.78601 XP_006070902.1.26621 XP_006180389.1.101512 XP_006866185.1.41390 XP_006923123.1.64745 XP_006977967.1.50099 XP_007113031.1.24612 XP_007172290.1.59432 XP_007461483.1.90284 XP_007634292.1.28591 XP_007937146.1.48129 XP_008012754.1.81039 XP_008054624.1.4292 XP_008571008.1.73410 XP_008689769.1.72690 XP_008832511.1.79516 XP_010386404.1.97406 XP_010842730.1.44457 XP_010980362.1.51371 XP_011360737.1.92234 XP_011714728.1.29376 XP_011852638.1.47321 XP_011945806.1.92194 XP_012331609.1.9421 XP_012501832.1.63892 XP_012604425.1.48125 XP_012875852.1.60039 XP_013921983.1.67126 XP_014951546.1.66739 XP_015262415.1.55130 XP_015340080.1.40921 XP_015471111.1.82291 XP_015471112.1.82291 XP_015679658.1.16292 XP_015731684.1.68032 XP_016016094.1.101085 XP_016059272.1.3490 XP_017356412.1.71028 XP_017746804.1.44346 XP_017905812.1.57651 XP_019279864.1.44245 XP_019279865.1.44245 XP_019517440.1.44202 XP_019595913.1.88060 XP_019780058.1.83887 XP_019820559.1.53367 XP_020649317.1.8467 XP_020764040.1.74333 XP_020860696.1.61212 XP_021069967.1.100879 XP_021265879.1.32913 XP_021400542.1.53032 XP_021509035.1.76796 XP_021557529.1.83697 XP_414511.2.86415 ENSPVAP00000007888 ENSMPUP00000009263 ENSP00000421288 ENSCAFP00000001835 ENSCAFP00000040757 ENSDNOP00000008402 ENSPTRP00000029564 gi|4759034|ref|NP_004721.1| 1dt9_A 5dmq_B ENSMODP00000015171 ENSLAFP00000013869 ENSPPYP00000017698 ENSMMUP00000007727 ENSMUSP00000025218 hso003004118.1 hso003004118.2 hso003004118.3 mmt010005192.1 ENSMUSP00000025218 ENSGALP00000003538 ENSRNOP00000026398 ENSRNOP00000026398 10090.ENSMUSP00000025218 10116.ENSRNOP00000026398 10141.ENSCPOP00000002146 13616.ENSMODP00000015171 9031.ENSGALP00000003538 9544.ENSMMUP00000034073 9598.ENSPTRP00000029564 9600.ENSPPYP00000017698 9606.ENSP00000353741 9615.ENSCAFP00000001835 9823.ENSSSCP00000015251 9913.ENSBTAP00000035133 9986.ENSOCUP00000005745 ENSOPRP00000015008 ENSMMUP00000007727 ENSMMUP00000034073 ENSLAFP00000013869 ENSBTAP00000035133 1dt9A ENSGALP00000003538 ENSCAFP00000001835 ENSCAFP00000040757 Hs4759034___KOG0688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]