SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015199 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015199
Domain Number 1 Region: 271-489
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 4.97e-90
Family Fibrinogen C-terminal domain-like 0.000000537
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015199
Domain Number - Region: 165-236
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0288
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015199   Gene: ENSMODG00000012138   Transcript: ENSMODT00000015483
Sequence length 493
Comment pep:novel chromosome:BROADO5:1:457486020:457547338:-1 gene:ENSMODG00000012138 transcript:ENSMODT00000015483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNDRWKAMGGAPQLEDGQQEKSQRQCGVVDRTLDLESRSTGLKSCLRHLLAVCLWRMSC
GYILCTVLLSVAVLLAVTVTGAIFFMNHYHTPVTEPPPVISTNPDEDNSALVTIEKADSS
RINIFIDPRCPDHADNFARLEGAQASVLRALTDRETEFRVTGGREQALLATLADEVPKLL
AQAIELQEDCEGLKRGHGTLGQGLNALQNEQGRLIQLLSESQSNMAHLVSSVSDVLDTLQ
KDRGAGRPRIKADLQKVPSRGARPRGCSNGSRPRDCLDIYASGQQEDGIYSVFPTHYPSG
FQVYCDMSTDGGGWTVFQRREDGSVNFFRGWEAYRDGFGKLTGEHWLGLKRIHALTMQAN
YELHIDLEDFDNGTAYAHYGNFAVGLFSVDPEEDGYPITISDYSGTAGDSFLKHNGMKFT
TKDQDNDHSENNCAAFYHGAWWYRNCHTSNLNGQYLRGHHSSYADGIEWSSWTGWQYSLK
FTEMKIRPVREEN
Download sequence
Identical sequences F7FU09
ENSMODP00000015199 ENSMODP00000015199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]