SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015219 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015219
Domain Number 1 Region: 33-352
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.58e-118
Family Bee venom hyaluronidase 0.0000034
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015219
Domain Number - Region: 415-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00433
Family EGF-type module 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015219   Gene: ENSMODG00000012146   Transcript: ENSMODT00000015503
Sequence length 436
Comment pep:novel chromosome:BROADO5:6:204359938:204371323:-1 gene:ENSMODG00000012146 transcript:ENSMODT00000015503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGDFKPSICVLLLILVDLTQGSGGPVLPNIPFVVVWNANTYLCEENFQVNISLDAFHV
VANPSQAFRGPNMTIFYRPNLGIYPWYTEAEQPINGGLPQNASLQDHLAKSSKDILATLP
ESDFHGIVVIDWEEWRPIWKTNWDTKKIYKHQSLALVREEHPEWSPSQVKETAKKQFEEA
AKEWMVETLNLGKLLQPRGLWGYYGFPDCYNYNFQKPNYTGECLPEIRHLNDKLSWMWEQ
SRALYPSIYLHLELEETGKSLLYVRSRLQEAFRVAQKTQNPGPSILPYGQIFYALTDSFL
PLEELENTIGESAAQGTDGIVMWLSESHELSKESCQDIKDYVDTILGPFVLNVTSSAYIC
SEALCSGHGRCARRQHYPHAFLFLEDSFSIYRQPGSGHLRLQGFLEEKSLEKMKTQFECR
CYTGWTGKHCAHLKSQ
Download sequence
Identical sequences F7CZ01
ENSMODP00000015219 ENSMODP00000015219 XP_007499963.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]