SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015227 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015227
Domain Number 1 Region: 819-873
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000391
Family Laminin-type module 0.00032
Further Details:      
 
Domain Number 2 Region: 273-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family Laminin-type module 0.094
Further Details:      
 
Domain Number 3 Region: 875-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 4 Region: 926-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 5 Region: 716-766
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 385-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 432-479
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 329-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 9 Region: 764-821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0001
Family Laminin-type module 0.00058
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015227
Domain Number - Region: 84-165
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00012
Family Galactose-binding domain 0.052
Further Details:      
 
Domain Number - Region: 974-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family Laminin-type module 0.044
Further Details:      
 
Domain Number - Region: 680-718
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Laminin-type module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015227   Gene: ENSMODG00000012155   Transcript: ENSMODT00000015511
Sequence length 1579
Comment pep:novel chromosome:BROADO5:1:457684415:457806803:1 gene:ENSMODG00000012155 transcript:ENSMODT00000015511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEFLSLSLGLLLCLGLRLARGGMDACYDGQGHPQRCLPVFENAAFGRQVQVTNTCGSPP
EDYCLQMGAPGDTKLCHRCDARDPDHHHNASYLTDFHSQEESTWWQSQSMAFGVQYPNSV
NITLQLGKAYEITYVRLKFHTSRPESFAIYKRSQSGGPWVPYQYYSASCEKTYGKHEGQY
LRPGEDERVAFCTDEFSDISPLSGGNVAFSTLEGRPSAYSFDESPILQEWVTSTELLISL
NRLNTFGDDIFKDPKVLQSYYYAITDFSVGGRCKCNGHSSECVLNEGGQLVCSCQHNTTG
PDCEKCLPFYQDRPWARGTAEAANECLPCNCSGLSEECFYDWELYRSTGHGGHCQNCRDH
TSGPHCEHCQENFYRWDQKQPCQPCDCHPAGSLSLQCDNSGTCECKPSVTGWKCDRCLPG
FHSLNEGGCRPCTCNVAGSLGTCDSRNGRCPCKSKVEGYLCDRCQPGTFNLKPQNPSGCT
SCFCYGHSMVCAASLHYGIHYIISDFHQGAEDWKIRGPQGREEPAQWSQSGIFLEPKGEE
LWEFIAPEKFLGDQRFSYGQPLSLTFQVPPGGSLPSIWLKLEGAGLALTLKPSSPTGTQQ
PGQPEEYLFMFSLQETSEDTERLLPAFHFQRLLANLTALQIQVVGPRSSSSSRPTGQVIL
TKVQLTSAGPGLAPEAPWVEECTCPRGYLGQFCESCSPGYKRETPLGGPYASCVPCTCNQ
HGTCDPETGICQCLHQTEGPSCERCTPGFYGNPFLGQPDDCKPCPCPGQSACTTIPESGE
VVCTHCPKGQRGRLCEMCDDGFFGDPLGTSGPPQPCQRCQCNENVDPNAVGNCDPTTGHC
LRCLHNTTGAHCEQCQEGFYGSALAPHPADKCTPCSCDPKGSARDQGACDPQTGQCSCLP
HVTGRDCSHCSPGFYDLQPERGCQSCKCHPVGSQENQCHPETGQCPCLPGVGGVACTRCQ
PNFFGFSAKGCRACNCSPLGSVTTQCHENSTCICKPGFVGYKCDHCKENFFLTAQGSQCQ
ECPICFSLVKKEATKLKSKLKVMERWLQKSDCDNPWRDYALQGESPRGDTYQDTREAFLE
QMEELGSSMRAARHQLKAASKNVNCTRSSLEKSCIQLVDIETLLQSTELEIQQASGVLTT
MVIPQEVPNQLTNWSHLATESQTLVKSHTDIATKIEAAARRALLASNTSYTLLWSLVEGK
EAQEIWHELEDRYQEMQKAQEELRTSTAQATTEAKSVLASVERISSEGAQHLVKLSTPEI
LPPTHLTRDLDRKLQDVEKTLTAQESMFTEAAQDLLATSQEELQKIQPFEQLREGAKTAL
TLATSSKAKARTTISDSKNLLDNLEEMKKTFPQPKDQGALRRKARVIQDRLIGETQKKTK
QAEKMLGNAASISATAKKKAKEAELLAKESTKNSKTLLRESKQEYRQASKLTNQARGTLR
DISRQVMLSRERRKEMEKVDWAGTGPGLSKVERNIQEARSSLEMDIKVLSVLLNRLGKLD
THQALASALNESEQELEPLRQRLDRQGSLQEKLSLLQQEAEQQELQIQDLDSDLKEIHAD
KQNLEDILRSLPEGCASWQ
Download sequence
Identical sequences F7CYR8
ENSMODP00000015227 ENSMODP00000015227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]