SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015235 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015235
Domain Number 1 Region: 72-126
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000128
Family Homeodomain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015235
Domain Number - Region: 126-240
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.034
Family Amylase, catalytic domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015235   Gene: ENSMODG00000012165   Transcript: ENSMODT00000015519
Sequence length 377
Comment pep:novel chromosome:BROADO5:1:138893062:139007499:-1 gene:ENSMODG00000012165 transcript:ENSMODT00000015519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQTIKDWFWLEELWLPPTIKWSDLEDHDGLVFVKPSHLYITIPYAFLLLIIRYFFERFV
ATPLAKAFGINRKVPMKIQHCPILENFFFQSTRHPSQNDLYGLAKKCNQTVQEVEIWFRR
RRNQEKPCRLKKFQEACWRFTFYLFLTIAGIGFLYDKPWLYDLWEVWNGYPKQPLLPSQY
WYYMLEMSFYWSLLFRLGSDVKRKASITSHVIHHLAALSLMSFSWCTNYIRSGTLVMLVH
DVADIWLESAKLFSYAGWKQTCNTLFFIFAAVFFISRLIIFPFWILYCTMIIPLYYLKPF
FSYIFLNVQLGILQILHLYWGYYVLKILRKYVLKKEMEDVRSDDEEDEGSAEEDEPESLK
NGLRKSRKPMPNGQPDH
Download sequence
Identical sequences F7CYJ2
ENSMODP00000015235 ENSMODP00000015235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]