SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015285 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015285
Domain Number 1 Region: 145-256
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-28
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 2 Region: 353-463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000432
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 264-300
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000419
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 4 Region: 544-581
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 308-349
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 505-542
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000314
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 7 Region: 463-503
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015285   Gene: ENSMODG00000012209   Transcript: ENSMODT00000015570
Sequence length 897
Comment pep:novel chromosome:BROADO5:1:427388487:427452509:-1 gene:ENSMODG00000012209 transcript:ENSMODT00000015570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFFWSVVQEFRLEDSFTKMFLLKLICSDRGRGSISSSGGGGGGSSSSSSSNSSVVLEAA
SCSQPGPGAAAADVAPRRPRASAQRSLRSCRQRLCSLRSNSGMEKLPAAGLEGGPSARAQ
FTVVCLVNLFLTGRLSSAVPSLAACSGKLEQHTERRGVIYSPSWPLNYPPGTNCSWYIQG
DHGDMITISFRNFDVEESHQCTTDWLMLGPSSRRDDYRICGSAIPPAFISARDHVWIFFH
SDASSSGQAQGFRLSYIRGKLGQAACQPDEFLCGNGKCLPGPWHCNAMDECGDGSDEKNC
SGLPTEIPRSLCPPGTFPCSGARSTRCLPTERRCDGTQDCGDNSDEAYCPDLSCGRRLGN
FYGSFASPDLFGADRGSDDLQCTWLVDTQDARRVLLQLELQLGYDDYVQVYDGLGERADR
LLQTLSYRSNHRLVSVEATEGQLTVTYHARAHSVGHGFNATYQVKGYCLPWEQPCGSDEG
CFSELQRCDGWWHCPGGKDEEGCPACQQDEYPCEGGSGLCYAPPDRCNNQKNCPDGSDEK
NCFSCQPGTFHCGTNLCVFETWRCDGQEDCQDGSDERDCLAAVPRKVITAALIGSLVCGL
LLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPV
YNASQASVLQNIRTAMRRQMRRHTSRRSASRRRLGRIWNRLFHRPRARGQIPLLTPSRAS
QTVLGDGIIRRAGGTSLSPPASSTGPPPMPPETVGQVVGEGPPETSSCALVSETEPLGSP
ISGTTAPPCAAHGLEPRHLNKELRAAVQAEPRKAFRDPLSESVSERLPAQGDPRGPSPPL
LSEGPGRLPLRKREPGSSGNSLCPPQTCQEEPLGVHGPPTPHSLLSDASDDESLLVC
Download sequence
Identical sequences F7CE47
ENSMODP00000015285 ENSMODP00000015285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]