SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015343 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015343
Domain Number 1 Region: 185-332
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.11e-39
Family Cap-Gly domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 37-140
Classification Level Classification E-value
Superfamily Cap-Gly domain 2.49e-35
Family Cap-Gly domain 0.00000336
Further Details:      
 
Domain Number 3 Region: 817-921
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000628
Family Myosin rod fragments 0.002
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015343
Domain Number - Region: 1385-1417
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0101
Family Retrovirus zinc finger-like domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015343   Gene: ENSMODG00000012253   Transcript: ENSMODT00000015629
Sequence length 1422
Comment pep:novel chromosome:BROADO5:3:485800524:485964509:-1 gene:ENSMODG00000012253 transcript:ENSMODT00000015629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMLKPSGLKAPTKINKPGSSALKTPAAAPAPVEKAISTDKTSSTPSPETHEEFVDDFRV
GERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTR
PSKLMRKLLTDDEANGTQAAPASGATSPLSTSMISVASSSPAAPSSSSIPHKISQPTAKE
PSHQVSNLTKTASESISNLSEAGSVKKGERELKINDRVLVGGTKAGVVRFLGETDFAKGE
WCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGFPSTTPAKAKAAAVRKVM
ATPGSLKRSPSASSLSSLSSVASSISSKPSRTGLLTETSSRYARKISGTTALQEALKEKQ
QHIEQLLAERDLERAEVAKATSHVGEIEQELALARDGHDQHVLEMETKMDQLRAMVEAAD
REKVELLNQLEEEKRKVEDLQFRVEEESITKGDLETQTKLEHARIKELEQSLLFEKTKAD
KLQRELEDTRVATVSEKSRIMELERDLTLRIEEVAELRKNLESCKPAGDVDTSLSLLQEI
SSLQEKLEATHVDHQHEINSLKECFGATEESHQKEVKALHAASEKLTKENESLKSKLDHA
NKENSEVIALWKSKLESAIASHQQAMEELKISFSKSVGTETAEFAELKTQIEKLKLDYQD
EIESLKSKQDSERSAHAKEMEILKAKLMKIIKEKEQGLEGLKFQLEKAEDQHLVEMEDTL
NKLQEAELKVKELKVLQAKCNEQTKVIDNFTSQLKATEEKLLDLDALWKANSEGKLEMEK
LSQQLEAAEKQIKNLEMEKIATSGKASHITKELQGKELKLINLQKNLSEVSQMKDDLEKE
LQILKKKFTDASEESVSIQQKMQETLNKLHHKEEQFSALSSDLKKLKYNLSDMEEKFKEK
DEREQQLTKAKEKLESEIAEIMKMSGDNSSQLTRMNEELRLKDKFVEELQFQLTKATDEA
ALLQKSIGEVTLKAEQDQKNVIAKNEEEKKELQKKVLDLERQVELSLKQCKDLQAKHEKA
NSEAVKQHEATLHGLKKTLLDTEGTLKEAQRKNSDLLKELEELKKQADKAKVAQTAEDAM
QLMEQMTKEKTETLASLEDTRQTNEKLKNELDALKENNSKNVEELNKSKERLTVENQKME
EFRKEIEALKQAAAWKSQQLSALQEENLKLTEELGRSREEVTSHQKLEGERSVLNNQLLE
MKKREFVYKADPDEERASLQKSISITSALLTEKDAELEKLRNEVTVLRGENASAKSLHSV
VQSLESDKVKLELKVKNLELKLKENKRQLSGFGGNSEEEESAQESQQMIDFLNSVIVDLQ
RKNQDLKMKVEMMSEAALNGNDLHNYDSDDQEKQFKKKPRLFCDICDCFDLHDTEDCPTQ
TQVPEDPPHSTHHGSRSEERPYCEICEMFGHWATNCNDDETF
Download sequence
Identical sequences F6YGW0
ENSMODP00000015343 ENSMODP00000015343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]