SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015407 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015407
Domain Number 1 Region: 42-176
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.28e-19
Family Canonical RBD 0.004
Further Details:      
 
Domain Number 2 Region: 224-319
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000887
Family Canonical RBD 0.0049
Further Details:      
 
Domain Number 3 Region: 176-211
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000942
Family Ran binding protein zinc finger-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015407
Domain Number - Region: 641-692
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00318
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015407   Gene: ENSMODG00000012301   Transcript: ENSMODT00000015693
Sequence length 817
Comment pep:novel chromosome:BROADO5:6:203844480:203873467:1 gene:ENSMODG00000012301 transcript:ENSMODT00000015693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSDYKRSSDDRRNDRYDDYRDYDSP
ERERERRNSDRSEDGYHSDGDYGEHDYRNDINDEWESKTIMLRGLPITVTENDIREIMES
FEGPQPADVRLMKRKTGVSRGFAFVEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPRP
KFEDWLCNKCCLNNFRKRLKCFRCGADKFDSEQEVPSGTTESVQSVDYYCDTIILRNIAP
HTVVDSIMTALSPYASLAVNNIRLIKDKQTQQNRGFAFVQLSSAMDASQLLQVLQSLHPP
LKIDGKTIGVDFAKSARKDLVLPDGNRVSAFSVASTAIAAAQWSSTQSQSGEGGNIDYNY
LQPGQEGYAQYAQYSQDYQQFYQQQAGGVENDTSTVPGAAVTTTSAAVVSQSPQLYNQTT
NPPGSPTEEAQPSTSTSTNTQAQTASPTGVVPGTKYAVPDTSTYHYDESSGYYYDPVTGL
YYDSNSQYYYNSLTQQYLYWDGEKETYVPAAECVAQQQTGLPSTKEGKEKKEKPKSKTAQ
QIAKDMERWAKSLNKQKENFKNSFQPVNSLREEERRESAAADAGFALFEKKGALAERQQL
IPELVKNGEEENPLKRGLVAAYSGDSDNEEELMERIESEEEKLTDWKKMACLLCRRQFPN
KDALVRHQQLSDLHKQNMDIYRRSRLSEQELEALELREREMKYRDRAAERREKYGIPEPP
EPKRKKQFDAGTVNYEQPTKDGIDHSNIGNKMLQAMGWREGSGLGRKCQGITAPIEAQVR
MKGAGLGAKGSSYGVSTADSYKDAVRKAMFARFTEME
Download sequence
Identical sequences F7EJ76
XP_001368163.1.35504 XP_007499947.1.35504 ENSMODP00000015407 ENSMODP00000015407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]