SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015423 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015423
Domain Number 1 Region: 105-246
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000235
Family Pentapeptide repeats 0.017
Further Details:      
 
Domain Number 2 Region: 430-546
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000302
Family Canonical RBD 0.0075
Further Details:      
 
Domain Number 3 Region: 667-767
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000112
Family Canonical RBD 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015423
Domain Number - Region: 968-1010
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0238
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 548-575
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0267
Family Ran binding protein zinc finger-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015423   Gene: ENSMODG00000012312   Transcript: ENSMODT00000015709
Sequence length 1143
Comment pep:novel chromosome:BROADO5:6:203745136:203839952:1 gene:ENSMODG00000012312 transcript:ENSMODT00000015709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGDPRPANRTGPFRGSQEERFAPGWNRDYPPPLKSHAQERHSGNFPGRDSLPFDFQGHT
GPPNPPFANVEDHSFSYGARDGPHADYRVGEGPGRDFMGGDFPSDFQNRDSQQLDFRGRE
IHPGDFRDREGPPMDYRGGDGTSMDYRGREASHMNYRDREAHAVDFRGRDGPPPDFRGRG
TYDLDFRGRDGSHSDFRGRDISDLDFRGRDQSHSDFRNRDMPDLDFRGKDGSQMDFRGRS
SGTADLDFRDRDTPPSDFRGRHRSRTDQDFRGREMAPHMEFTDREMPPMDPNILDFIQPS
TQDRERSGINVNKREESTHELAGTERPPFGIQKGEFQHSETRAREGDSHGLGLENESPLD
FRNNQRPLQDQDKTPQIFANKQPLSGGEQRSDSGLVFKEEVGLDFLGRQDTDYRNMEYRD
VDHRVPGNQMFDYSHSKSFPEGKIVKDSRQDLQDQDYRTGPTEEKPSRLIRLGGVPENAT
KEDILNAFRTSDGTPVKDLQLKDYSSGYDYGYVCVEFSLLEEAIGCMEANQGTLKICDKE
VTLEYSPSPDFWHCKRCKVSTVGYRSSCSYCKFPREVTEAKASKVQQELATYPEPQKSPV
QPAVLTEKQQSHPQTPADKEPETKKREEGRERRLGQEQRRDSERYPSRREGHDTTTRRDN
EKDQWSGESRQDGESKTIMLKRIYRSTPPEVIVEVLEPYVRLSTANVRIIKNRTGPMGHT
YGFIDLDSHSEALRVVRILQNLDPPFSIDGKMVAVNLATGKRRNDSGDHSDNMYYNQGKK
YFRERKGGSRNSDWSSDSNRHEQQSSSDCYIYDSVTGYYYDPLAGTYYDPKTQQEVYVPQ
DPGSPGAESKGKKHNNQGKPNEKKDVSKRDSKEKKDRARSTPTKEVSSEGKAPAEDVFKK
PLPPTVKKEESPPPPKVVNPLIGLLGEYGGDSDYEEEEEEEKPPPPQTRPAQPPQREEFS
KKENEEDKLTDWNKLACLLCRRQFPNKEVLLKHQQLSDLHKQNLEIHRKIKQSEQELAYL
ERREREGRYREKGSDRKEKLHFSDSPDRKRMKYSRETDSDRKSSNKVGIDSNNKGGCVLQ
SPGWKKGAGLGYGQPGLASAEETEGWTRGPGVGSQGKPSKRQSNETYRDAVRRVMFARYK
ELE
Download sequence
Identical sequences F7EIT0
XP_007499941.1.35504 XP_007499942.1.35504 ENSMODP00000015423 ENSMODP00000015423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]