SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015541 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015541
Domain Number 1 Region: 25-148
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-18
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 2 Region: 145-181
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015541   Gene: ENSMODG00000012411   Transcript: ENSMODT00000015828
Sequence length 388
Comment pep:novel chromosome:BROADO5:3:298799906:299137347:-1 gene:ENSMODG00000012411 transcript:ENSMODT00000015828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSARYNFTTDPDFKDLGVLKPLPVCEFEMGGPEGIVESIQIMKEGKASATEAVDCKWY
IRAPPRSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLG
VIRMWADEGSRSSRFQMLFTSFQEPPCEGNTFFCHSNMCINNTLVCNGLQNCVYPWDENH
CKEKRKTNLLDQLTNTSGTVIGVTSCIVIILIIISVIVQIKQPRKKFVQRKADFDQTVFQ
EVFEPPHYELCTLRGTGATADFADVADDFENYHKLRRSSSKCIHDHHCGSQLSSTKGSRS
NLSTRDAPLLAEMPPQPVKPLIPPMNRRNILVMKHNYSQDAAEACDIDEIEEVPTTSHRL
SRHDKSVQRFCLIGSLSKHESEYNTTRV
Download sequence
Identical sequences F6PME9
ENSMODP00000015541 ENSMODP00000015541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]