SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015553 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015553
Domain Number 1 Region: 641-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-89
Family Protein kinases, catalytic subunit 0.0000000578
Further Details:      
 
Domain Number 2 Region: 210-287
Classification Level Classification E-value
Superfamily HR1 repeat 3.4e-24
Family HR1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 133-207
Classification Level Classification E-value
Superfamily HR1 repeat 1.7e-23
Family HR1 repeat 0.0000914
Further Details:      
 
Domain Number 4 Region: 27-106
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-20
Family HR1 repeat 0.00031
Further Details:      
 
Domain Number 5 Region: 379-478
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000386
Family PLC-like (P variant) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015553   Gene: ENSMODG00000012423   Transcript: ENSMODT00000015841
Sequence length 958
Comment pep:novel chromosome:BROADO5:2:15903290:16084985:-1 gene:ENSMODG00000012423 transcript:ENSMODT00000015841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNTERGEILLTELQGDARSLLLPENVSTGQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKNLAYVDNILKKSNKKLEELHHKLQELNAHIVVTDPEDLTDCPR
TPDTPNSDPRCATSNKLMALKKQLDIELKVKQGAENMIQMYSNGSSKDRKLLATAQQLLQ
DSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVMK
LLGSGKVADRKALSEAQARFNESSQKLDLLKYSLEQRLSELPKNHPKSSIIIEELSLVGS
PTLSPRQSVISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVTLPGWSPS
ETRSSFMSRTSKSKSGSSRNLLKTDDLSNDICAVLKLDNTVVGQTSWKPISNQSWDQKFT
LELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFNPV
IERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPGPT
TVPVVDVRIPELSPPASDSTVTKLDFELEPEAPPAPPRTSSFGEIHEPSELRVLDVSGQD
SETTFNFENDRNSIVPKNQPEYEPPVLQSSLEYGGVQEPEERRSPQRFQFSLQDFRCCAV
LGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFLVN
LFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVYRD
LKLDNLLLDTEGFVKIADFGLCKEGMGFGDRTSTFCGTPEFLAPEVLTETSYTRAVDWWG
LGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRLGA
GEKDAEDVKKHPFFRLIDWNALLAKKVKPPFVPTIRGREDRIPLSCACLKWKEEQLVI
Download sequence
Identical sequences F6PKG7
ENSMODP00000015553 ENSMODP00000015553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]