SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015573 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015573
Domain Number 1 Region: 3-61
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000377
Family TNF receptor-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015573   Gene: ENSMODG00000012440   Transcript: ENSMODT00000015861
Sequence length 383
Comment pep:novel chromosome:BROADO5:X:9116587:9208123:1 gene:ENSMODG00000012440 transcript:ENSMODT00000015861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MECQENQYRDQWGFCVTCQQCGPGQELSKECGYGEGGDAFCTPCPPRRYKSGWGHHSCQA
CLTCAVINRVQKVNCTATSNGVCGDCLPRFYCKTRIGGLQDQECISCTKQTPVSEVQCMC
AFRLSSVKLEVPTAPPQEATLMVLTSSVLIVFVLALISFAVFYCKRFLKRQFRHGFIGYP
DFRGQRELSQTSDYAGPCPGRELGMKNLGPVIEQNGGGFLFLACEDSVQFVADGPAPRAE
GNDRHFHLSCDPYPGQLVCNAAAAAAAAAAAVDTRALIHACPSAEGQTESLGNPPTLPSC
ASETQSCWAHAPVECTELDLHKFSSCSPYAGAEGHREAVIWAMPGGTGDRMGFTPSLYYL
EGKSPTPDSSFKVSSAKNGHVSW
Download sequence
Identical sequences F6PJH9
ENSMODP00000015573 ENSMODP00000015573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]