SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015582 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015582
Domain Number 1 Region: 53-141
Classification Level Classification E-value
Superfamily Release factor 2.49e-20
Family Release factor 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015582   Gene: ENSMODG00000012450   Transcript: ENSMODT00000015871
Sequence length 173
Comment pep:novel chromosome:BROADO5:3:486999968:487002275:1 gene:ENSMODG00000012450 transcript:ENSMODT00000015871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLGSTSLPASLGRFSRGLWGLWLWKKPVFLFPRMGACGPQVTGKTDAHNLLPLNERDL
EEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVKCHQTRSVDQNRKLAREILQGKVDLFY
RGEDSHLHKVRKEAEKKKRERKKKAKETLEKKRLLKELMLTEPSPKAPLSRDE
Download sequence
Identical sequences F6PJ93
ENSMODP00000015582 ENSMODP00000015582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]