SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015678 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015678
Domain Number 1 Region: 611-994
Classification Level Classification E-value
Superfamily RNI-like 5.3e-79
Family 28-residue LRR 0.00000835
Further Details:      
 
Domain Number 2 Region: 4-91
Classification Level Classification E-value
Superfamily DEATH domain 4.83e-20
Family Pyrin domain, PYD 0.0036
Further Details:      
 
Domain Number 3 Region: 211-384
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000241
Family Tandem AAA-ATPase domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015678   Gene: ENSMODG00000012527   Transcript: ENSMODT00000015968
Sequence length 1061
Comment pep:novel chromosome:BROADO5:4:400859671:400882540:-1 gene:ENSMODG00000012527 transcript:ENSMODT00000015968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMADTILCCLVTYLEELECGELSKFKMYLGLEAEREGEERVPRGRMEKAGPLDLAKILV
AQWGPAEAWELALRVFNRINRKDLWERGCQEPLVRDAPRSLELIALDSCRRVSGSLAGAC
PGAPSKDPQETYREHVRRKYRFIEDRNARLGELVNLSQRYTRLLLVKEHATLIRAQRELL
ALGRQHALCLDQRASPIHIETLFEPDEERPEAPHSVVLQGAAGIGKSILAQKVMLDWAEG
HLYSDRFDYLFYVNCREMNQVRERSLEDLISLCWPERNVPISEIVRVPERLLFIIDGFDE
LQPFFHEPTDCCCLRQGERRPVEALLSCLLTRKLLPERSVLITTRPTTLETLRHLLEHPR
HVEILGFSEAQRQEYFYKFFGNEEQARQGLAVVRDNEPLFTLCFVPMMCWIVCTCLKQQL
DVGRPFPHTSKTTTAVYMFYLLSLLQPKAGGSRAQPPPSLRGLCSLAAAGLWRQRILFDE
DELRRHGLEAAHVSAFLNMNVFHKDIQRERYYSFIHLSFQEFFAAMFYALEGELGASPAG
LTGLLDHYAKCERSSLALAVRFLFGLLNEETRGYLDRRLGWRISPRTKRDLLRWIRAKAR
SEGSTLQRGALELFTCLYEIQEEDFIQRALDYFQVVVVSEMATKMEHVASSFCVRNCWSA
LVVHLCSAPFSADGEQEPEGAEGPQNQPLKPSEKNILPETYCEHLAAALSTNRNLVELVL
YRNALGDRGVRLLCQGLRHPNCQLQNLRLKRCRISAAACQDIAAALVTNPNLIRLDLSRN
VLGAAGVRLLAGGLLHPRCRLQMLQLRRCHVDGEACQELSKVLSTSQHLAELDLTGNALG
ESGLQLLCPGLGHSACKLQTLWLKICHLTPAACQNLSSVLSTNQSLTELDLSLNDLGDAG
VTSLCEGLCHSKSQLHTLRLGICRLTFVSCEALSTTLQSNVHLKALDVSFNDLEDMGVHL
LCEGLQHPTCKLQKLWLDSCCLSGAACRDLASALGANQTLRELYLTNNALGDAGVQLLCQ
RLSQASCRLRTLWLFGTELTDGTQQALAALRGSKPHLDIGS
Download sequence
Identical sequences F6PZU3
XP_007492316.1.35504 ENSMODP00000015678 ENSMODP00000015678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]