SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015832 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015832
Domain Number 1 Region: 40-287
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-52
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 2 Region: 296-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000838
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015832   Gene: ENSMODG00000012638   Transcript: ENSMODT00000016123
Sequence length 343
Comment pep:novel chromosome:BROADO5:Un:51725197:51744496:1 gene:ENSMODG00000012638 transcript:ENSMODT00000016123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPAFAAAVEGRSVSGAEATLNSQNPKAPARRREGWAEEVLLLARRTDLRRISLDMPDFTD
IILQVDDIRHAIAIDYDPVERYVYWTDDEVRAIRRAYLDGSGAQTLVSTEINDPDGIAVD
WVARNLYWTDTGTNRIEVTRLNGTSRKILISENLDEPRAIVLNPAMGYMYWTDWGESPKI
ECAHLDGQARRVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRRTLLEDK
LPHIFGFTLLGDYIYWTDWQRRSIERVHKVKANRDIIIDQLPDLMGLKAVNVARVIGTNP
CAEKNGGCSHLCFFTPHATKCGCPIGLELLTDLQTCIIPEAFL
Download sequence
Identical sequences H9H6K7
ENSMODP00000015832 ENSMODP00000015832 13616.ENSMODP00000015832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]