SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015858 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015858
Domain Number 1 Region: 28-142
Classification Level Classification E-value
Superfamily Prefoldin 3.14e-21
Family Prefoldin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015858   Gene: ENSMODG00000012675   Transcript: ENSMODT00000016150
Sequence length 510
Comment pep:novel chromosome:BROADO5:1:431872250:431938217:-1 gene:ENSMODG00000012675 transcript:ENSMODT00000016150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAQPRPSLAAAAAASSTQPLRSEHVARLREEQEKVVTGCQEKIQHWRKVEHDYEALQER
LSTLPDKLSYDIMVPFGPLAFMPGQLVSTNEVTVLLGDNWFCKCSAKQAVGLVEHRKKHV
RKALDDLKKVMKNFESRVEFTEDLKRMSDAAGDIVDIREDIKNDIEVKGKHRTAHKPHSK
PKTLDVFEADFVDDSKSKDNFLSEKELWARLDELERQEDLLGELSRKSDTLFANGEDMTS
SEEEKEDQKTDVMKHRITDSFTQGSFQKDITNSKLLNGQVNGSSSYSNDDDDDDDDLGVG
DNSVPTIYFSHTVEPKRVRINTGKNTTLKFSEKKEEAKRKRRNSNGNSSHCIPELPNIRT
PADVYRVFVDVVNGEYVPRKSILKSRSRENSVCSDTSESSAAELEDRRGGIRSLSHDEAA
CSDASEGILEEEEDEHENQQKKLLSLSGKLEAFSGTVIEKELLSPIIPHPGTVHPALPTI
PERKEVLTEVSEETTKRISKFKAARLQQRN
Download sequence
Identical sequences K7E0P3
XP_007474861.1.35504 ENSMODP00000039344 ENSMODP00000015858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]