SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015935 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015935
Domain Number 1 Region: 73-163
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000706
Family DEATH effector domain, DED 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015935   Gene: ENSMODG00000012740   Transcript: ENSMODT00000016229
Sequence length 376
Comment pep:novel chromosome:BROADO5:Un:67050282:67059682:-1 gene:ENSMODG00000012740 transcript:ENSMODT00000016229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQGGRGQRGPPAVPPGVPTVLLLGSQAVAATSHELHVWRLNSAPWSGPMVGPRGQGSPC
WEEDECLDYYGLQPLHRVFQVVGAQLSEQELAVLSFLLEEALPAPQDSPPGLAPRGGPQP
APSRSGLELLLELERRGQCDEARLGPLKQLLRVLSRQDLLPKLSLKRMRPVSPERHSCSP
SGSETERPEGNCLGPASTTSPRAQWETGSPPGKRQRRSLGRSSARGRRRRGPQGASRARN
PGSSSTPNRVTCDIRLRVRAEYCEHGSALAQGVASRRPQSLARQLDLFGQAMAVLKSRDL
GSVVCDIKFSELSYLDAFWGDYLSGALLQSLRGFLTEALREAVGREICLLVSVDEGDYEA
GRRRLLLLGGQAPPPR
Download sequence
Identical sequences H9H6L1
ENSMODP00000015935 ENSMODP00000015935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]