SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016037 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000016037
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0011
Family AN1-like Zinc finger 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016037   Gene: ENSMODG00000012820   Transcript: ENSMODT00000016334
Sequence length 154
Comment pep:novel chromosome:BROADO5:1:435094498:435107766:-1 gene:ENSMODG00000012820 transcript:ENSMODT00000016334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPSSAENKHDA
KRRRTERVRREKINSTVNKDLENRKRSRSSSQSDHIRRGRGRPKSASAKKHEEERERQEK
EVDIYANLSDEKAFVFSVALAEINRKIINQRLIL
Download sequence
Identical sequences F7DY20
13616.ENSMODP00000016037 XP_001363112.1.35504 XP_020840755.1.61212 ENSMODP00000016037 ENSMODP00000016037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]