SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016049 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016049
Domain Number 1 Region: 10-174
Classification Level Classification E-value
Superfamily RL5-like 3.53e-60
Family Ribosomal protein L5 0.0000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016049   Gene: ENSMODG00000012828   Transcript: ENSMODT00000016346
Sequence length 178
Comment pep:novel chromosome:BROADO5:4:360037811:360045402:1 gene:ENSMODG00000012828 transcript:ENSMODT00000016346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQDQGEKENPMRELRIRKLCLNICVGESGDRLTRAAKVLEQLTGQTPVFSKARYTVRSF
GIRRNEKIAVHCTVRGAKAEEILEKGLKVREYELRKNNFSDTGNFGFGIQEHIDLGIKYD
PSIGIYGLDFYVVLGRPGFSIADKKRRTGCIGAKHRIGKEEAMRWFQQKYDGIILPGK
Download sequence
Identical sequences F7DD44 F7EFX6
ENSMEUP00000012535 ENSOANP00000000539 ENSMODP00000016049 ENSOANP00000000539 9258.ENSOANP00000000539 XP_001363094.2.35504 XP_001512081.1.37387 XP_020838732.1.61212 ENSMODP00000016049 ENSMEUP00000012535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]