SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016097 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016097
Domain Number 1 Region: 44-159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-33
Family Spermadhesin, CUB domain 0.00019
Further Details:      
 
Domain Number 2 Region: 174-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.42e-19
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 3 Region: 296-332
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016097   Gene: ENSMODG00000012864   Transcript: ENSMODT00000016394
Sequence length 525
Comment pep:novel chromosome:BROADO5:1:435461815:435498877:-1 gene:ENSMODG00000012864 transcript:ENSMODT00000016394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALEKLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASP
NYPESYPPNKECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEIRDGPFGFSPLIDR
YCGVKSPSLIRSTGRFMWIKFSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFE
LSGADGIVRSSQVEQEDKTKPGQAVDCIWTIKATPKAKIYLRFLDYQMEHSNECKRNFVA
VYDGSSSIENLKAKFCSTVANDVMLQTGIGVIRMWADEGSRLSRFRMLFTSFVDPPCTGS
TFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGLFEQITKTHGTIIGITSGIVLV
LLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELE
NYQKMRRSSTASRCIHDHHCGSQASNVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKK
SSYTFKQSHECSEQAIEDRVMEEIPCEIYVRGREDSAQGSMSIDF
Download sequence
Identical sequences F7C941
XP_007474884.1.35504 ENSMODP00000016097 ENSMODP00000016097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]