SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016197 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016197
Domain Number 1 Region: 455-702
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.63e-54
Family Eukaryotic proteases 0.0000328
Further Details:      
 
Domain Number 2 Region: 186-272
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 3 Region: 92-187
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-32
Family Kringle modules 0.00025
Further Details:      
 
Domain Number 4 Region: 277-362
Classification Level Classification E-value
Superfamily Kringle-like 2.39e-31
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 5 Region: 365-453
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-31
Family Kringle modules 0.0001
Further Details:      
 
Domain Number 6 Region: 20-104
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.34e-19
Family Hairpin loop containing domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016197   Gene: ENSMODG00000012944   Transcript: ENSMODT00000016497
Sequence length 704
Comment pep:novel chromosome:BROADO5:6:203173160:203201972:-1 gene:ENSMODG00000012944 transcript:ENSMODT00000016497 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVVLLLSNLCASTSETRSPLNDFQSLSAMELHHASHRVEAWKTVMNVEECAQHCNQH
LDCRAFHFTPRNQGCQLLSWTQHSDQTQLQKNVEYDLYQKKDYVRDCIVNNGISYRGTVS
TTIGGISCQHWNQKFPADHKYTPNSQNGLEKNYCRNPDSDQQGPWCYTTNPKIRFQTCGI
KTCQKATCFTCNGEDYRGSLDYTESGQECQRWDLQYPHRHPYNPNKYPDKNLDDNYCRNP
DSSERPWCYTTDPQREREFCSIPRCGQKRRQSPPKHTTHNCFKGKGENYRGTANTTATGI
PCQRWDAQTPHQHHFLPENYECKDLRENFCRNPDGSEAPWCFTSRPGMRVAFCFQIKRCP
DDIKIEECYYENGEQYRGSVNKTRKGIICQHWSQETPHKPQFTPTTHPQLEENFCRNPDG
DRYGPWCYTMDPGTPFDYCALKPCSNDPKTSILATSDPVLFQECGKREERRSRLLRVVGG
HPGNSPWTVSLRNRQGQHFCGGSLVKDQWVVSALQCFPSCHASLTGYEAWLGTLFKNPQS
SDPGLQKIPLMKMVCGPPGSQLIMIKLERPAVLNNRVALICLPPESYMVPDNTQCEIAGW
GETNGTGNDTVLNVARLRVITNEECNIKHRGKVKKNELCTMSPMVPVGACEGDYGGPLAC
YTHDCWVLEGIIIPNRVCARPGWPAIFLRISMYVDWINKVIKLS
Download sequence
Identical sequences F7G1K1
ENSMODP00000016197 ENSMODP00000016197 XP_007499923.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]