SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016269 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016269
Domain Number 1 Region: 24-357
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.9e-113
Family Putative alpha-L-fucosidase, catalytic domain 0.000000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016269   Gene: ENSMODG00000013008   Transcript: ENSMODT00000016569
Sequence length 453
Comment pep:novel chromosome:BROADO5:4:360172227:360328076:-1 gene:ENSMODG00000013008 transcript:ENSMODT00000016569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAVQLLPLLLLVASALAGYTPRYTPDWDSLDARPLPAWFDEAKFGVFVHWGVYSVPAW
GEWFWYYWKDRKDPDAEAFMRNNYPPGFSYADFGPQFQAKFYDPKKWAEIFEAAGARYVV
LTSKHHEGYTNWPSPTSWNWNSMDVGPHRDLVGELGPHLREKNIHFGLYHSLLEWFHPFY
LLDKQNNFTTQNFVAAKVLPELVDLVNRYKPDLIWSDGEWEAPDAYWNSTEFLAWLYNDS
PVKDQIVVNDRWGREDLCKHGGYLTCHDKYKPDTLPKRKWEMCTTLDKKTWGYRRTMESN
DVMTELEIISDLVDVVSLGGNYLLNIGPTKDGVIIPIFQERLLSVGRWLSINGEGIYASK
PWRVQMEHTTSRLWFTTKQSAVYVFFADWPMSGVLQLTSPVPTNMTTVMMLGIPELLKWS
EDSLDRSLLIYLPKLSPDLADMKIWTLKLKGVE
Download sequence
Identical sequences F7C844
ENSMODP00000016269 ENSMODP00000016269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]