SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016271 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000016271
Domain Number - Region: 86-237
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0392
Family Type II DNA topoisomerase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016271   Gene: ENSMODG00000013010   Transcript: ENSMODT00000016571
Sequence length 575
Comment pep:novel chromosome:BROADO5:6:202317109:202373861:1 gene:ENSMODG00000013010 transcript:ENSMODT00000016571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILFFKYYFRTNKSSSWNNNLNDYSSLTDSQFLFGSQFCPENSQSLSASLDFSTHLRHAKT
SQSEDVSCFHKVSLLPQLFGGDTKDEKLLLPHLPMGKSKSILEQFEENKKRAQDKQDSEA
LNSFISYVRESMHKLQTSVEKLEEELSSRNQTVLDSLEAVAKTLQESAQAHCDLMLDALR
DRSRIEQRALELERLLETREAEFLDMKSSLKNLEVLAAEQSKQHQRLCDQLDQLNFPKMQ
SLDLEAQLSCHVNDRSPQTVSALLQASNLSRKGTSISKSSDISETIMLPPHLNPLASSHQ
SEKCSAEKQEAKDETHRPLDKKNQNGKDEAVQTDLEPQDPAKKWSESWDSSSKIYGDHCK
RDIVVQETSQFPSMAVKDLGTKAKPTCILQECQPTALFCSNTHDQNKVQEQKGMSVDVRK
RGKRKKPRKSQRGSFIKRKSSGLLRNTFTFNSRIGGPQAAAPKQRNVFLGQVENPRQPVP
LLCPHKTVQPVVKVRRKAEKAERADSPHKAANNFFLNDYSSQETSSPFPNSTEGDKYMSW
FSNINSDNSESSNAMEAEENTFYAIVFDSSDDDNR
Download sequence
Identical sequences F7C7L7
ENSMODP00000016271 13616.ENSMODP00000016271 ENSMODP00000016271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]