SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016307 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016307
Domain Number 1 Region: 594-652
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000142
Family BSTI 0.039
Further Details:      
 
Domain Number 2 Region: 979-1038
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000343
Family BSTI 0.055
Further Details:      
 
Domain Number 3 Region: 1368-1427
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000132
Family ATI-like 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016307
Domain Number - Region: 2085-2126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016307   Gene: ENSMODG00000013037   Transcript: ENSMODT00000016608
Sequence length 2155
Comment pep:novel chromosome:BROADO5:4:227525864:227615308:-1 gene:ENSMODG00000013037 transcript:ENSMODT00000016608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSSLLRIWVSFIFTLVRHQVQPRELMYPFWQNDTKTPKVDDGSSSEIKLAIPVFFFGV
PYRTVYVNNNGVVSFNVLVSQFTPESFPLTDGRAFIAPFWADVHNGIRGEIYYRETMDPV
ILRRATKDIRKYFKDMATFSAIWVFIVTWEEVTFYGGSSTTPVNTFQAVLISDGASTFTL
FNYHEINWTTGTASGGDPLTGLGGVMAQAGFNGGNLTNFFSLPGSRTPDIVNIQETTNVN
VPGRWAFKVDGKEIDPANGCTSRGQFLRRGEVFWDDMNCTIKCRCLDFNNEIFCQDASCS
PYEVCEPKGKFFHCNPLESSTCVVFGEPHYHTFDGFLFHFQGSCAYLLARQCLHVSSLPF
FSVEAKNEHRGGSAVSWVKELSVEVYGHKILIPKGSYGRVKVNDLVASLPVSIDLGAVKI
YQSGMSTAVETDFGLLVTFDGQHYASISVPGSYINSTCGLCGNYNKNPLDDFLRPDGKPA
TSVLDLGESWRVYHPDWKCTSGCVDNCTQCDAVTEALYFGTDYCGFLNKSDGPLWECGAI
VDPTIFIHSCVYDLCSVQDNGTLLCQAIQAYALVCQALGIPIGDWRIQTGCVSTVQCPSF
SHYSVCTSSCPDTCSDLTASLSCLTPCTEGCECNEGFVLSTSQCVPLHKCGCDFDGHYYT
MGEFFWATANCTVQCLCEEGGDVYCFNKTCREGEVCSVEDGYQGCFPKRETVCLVSQNQV
LHTFDGVAYAFPMEFSYTLLKTCPERPDYLEIDINKKKPDAGPSWLRVIRIQVADQEIKI
GGIGASEIRLNGQEVELPFFHSSGKLEIFRNKNSTTVESKGVVTVQYSDVGMLHIRLSTV
YFNCTGGLCGFYNANATDELCFPNGKCTDNVAVFLESWTTFEEICNGECGDLLKACNNDS
ELLKFYRSRSRCGIINDPSNSSFLECHGVVNVTAYYRTCLFRLCQSGGNESELCDSVARY
SSACKNADVEVGPWRTYDFCPLDCPENSHFEECMTCTETCETLAIGPVCVDSCAEGCQCD
EGYALRGTQCVPRSECGCNFEGHQLSTNETFWVDLDCQLFCYCNGTDNSVHCESIPCKDD
EYCMEESGLYYCQARTDASCIVSGYGHYLTFDGYPFDFQSSCPLILCTTISRQSTDQFPK
FTVTAKNEDRDPSLALWVKQVDVAVFGYSIVIHRAYKHTVLVNNERLYLPLKLSQGKINI
FSFGFHVVVETDFGLKVVYDWKTFLSVTVPRNMQNGTFGLCGRYNGNPDDDLEMPMGLMA
SSVNEFGQSWVKRDTFCQVGCGDRCPSCAKVEGFSKVQQLCSLIPNQNAGFAKCHSKVNP
SFFYKNCLFDSCIDGGAVQTACSWLQNYASTCQTQGIAVTGWRNYTSCSVTCPPNSHYES
CVSVCQPRCAAIRLKSDCNHYCVEGCQCDAGYVLNGKSCILPHSCGCYSDGKYYEPKQLF
WNSDCTRRCRCFRRNLIQCDPRQCKSDEECALRNGVRGCFSMKSSYCIAAGGGVFRTFDG
AFLRFPANCAFVLSTICQKLPDISFQLIINFDKWSSPNLTIISPVYFYINEEQILINDRN
TVKVNGTQVNVPFITGLATKIYSSEGFLVIDTSPDIQIYYNGFNVIKISISERLQNKVCG
LCGNFNGDLTDDYVTLRGKPVVSSVVLAQSWKTNGMQKSFLPPSCNELQYSQYASTCDNV
HIQKMQGDGYCLKLTDMKGFFQPCYGLLDPLPFYESCFLDGCYNHKKFQLCGSLAAYGEA
CRSFGILSTEWIEKENCSGVVEDPCVGADCPNRSCELDNGGELCGCIEPPPYGNNSHDII
DAEVTCKAAQMEVSISKCKLFQLGFEREGVRINDRHCSGIEGEDFISFQINNTKGNCGNI
VQSNGTHIMYKNTVWIESANNTGNIITRDRTINVEFSCAYELDIKISLDSVVRPMLSVIN
LTVPTQEGSFTTKMALYKNASYKHPYRQGEVVLTTRDVLYVGVFVVGADSTHLILTLNKC
YATPSRDSNDKLRYFIIEGGCQNIKDNTIGIEENGVSLTCRFHVTVFKFIGDYDEVHLHC
AVSLCDSEKYSCKINCPQNSRIATDYTKEPKEQIISVGPIRRKRLDWCEDNGGCEQICTS
RVDGPLCSCVTGTLQEDGKSCRASNSSIELQVWISLLILTQISLWHLVYKSGTTS
Download sequence
Identical sequences F7GBM0
13616.ENSMODP00000016307 ENSMODP00000016307 ENSMODP00000016307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]