SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016391 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016391
Domain Number 1 Region: 409-492
Classification Level Classification E-value
Superfamily DEATH domain 3.23e-18
Family DEATH domain, DD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016391   Gene: ENSMODG00000013098   Transcript: ENSMODT00000016693
Sequence length 528
Comment pep:novel chromosome:BROADO5:2:283378280:283421840:-1 gene:ENSMODG00000013098 transcript:ENSMODT00000016693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCLFGSFIQENLPLQFLLLMGVPVATVFLLVQCLDWSCPFSRRRRKSGTLEGLEEPVPVP
LSLPEDDIPRQSPPATLTEMATFYQELYTPTEGRTVIQQLMNKLLVFAWREVDHQGGCLL
LKDMGISLFIPPGAVALGRREQISLALVWDLSDAPSLLSKQALVSPVVACSPHGASFLKP
CTLTFKHCAQNPNHVCTYSSNTALLDTKIWKPLGQPGAHTSRDECRIPISHFSLYTCVLE
APDAYDARKWLQLAVFCSPLLPGQSHLQLRVYFLNNTPCALQWAVTNEEPHAGHLRGPCQ
LFDFMGTRGDQYLKLKYISEGWENVDDSSCQMVPYLHIWHGKCPFRSFCFRKKAGTNEDK
DNMALTNEIIVTMHTFQNGLETKYMEILRFQASEEESWAVPPPVSRSAPCNRLPPELFEQ
LQMLLEPSSITGNDWRRLASHLGLCGMKIRFLSCQRSPAAAVLELFEEQNGSLQELHYLM
TSMERLDCASAIYVYLDGKQSQSPTPCCTPVLALKTRDNEGLELDVKL
Download sequence
Identical sequences F7EXB5
ENSMODP00000016391 13616.ENSMODP00000016391 ENSMODP00000016391 XP_001379613.1.35504 XP_016286536.1.35504 XP_016286537.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]