SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016461 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016461
Domain Number 1 Region: 432-1186
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 1.44e-246
Family Type II DNA topoisomerase 0.00000000000404
Further Details:      
 
Domain Number 2 Region: 35-265
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-63
Family DNA gyrase/MutL, N-terminal domain 0.000000235
Further Details:      
 
Domain Number 3 Region: 256-417
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-41
Family DNA gyrase/MutL, second domain 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016461   Gene: ENSMODG00000013152   Transcript: ENSMODT00000016764
Sequence length 1557
Comment pep:novel chromosome:BROADO5:2:197121583:197147189:1 gene:ENSMODG00000013152 transcript:ENSMODT00000016764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLSPLQPVNENLQINKIKKNEDTKKRLSVERIYQKKTQLEHILLRPDTYIGSVEVVTQ
QMWVYDEEVGLNYRDVTFVPGLYKIFDEILVNAADNKQRDPKMNCIKVTIDSENNTISIW
NNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTV
ETACKEYKKMFKQTWMDNMGKAGEMTLKPFSGEDYTCITFQPDLSKFKMTSLDKDMVALM
SRRAYDIAGSTKDVKVFLNGNRLPVKGFRSYVDLYVKDKLDETGNPLKIIHEEVNHRWEV
CLTMSEKGFQQISFVNSIATSKGGRHVDYVADQIISRLIDVVKKKNKGGVAVKAHQVKNH
MWIFVNALIENPTFDSQTKENMTLQAKNFGSKCELSEKFIKAAIGCGIVESILNWVKFKA
QVQLNKKCSAVKHNRIKGIPKLDDANDAGSKNSTDCTLILTEGDSAKTLAVSGLGVVGRD
KYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDADSLKSLRYGKIMIM
TDQDQDGSHIKGLLINFIHHNWPSLLKHCFLEEFITPIVKVSRNKQEMSFYSLPEFEEWK
NTTENHKKWKVKYYKGLGTSTSKEAKEYFSDMSRHRIQFKYSGPEDDAAISLAFSKKQID
DRKEWLTHFMEDRRQRKLLGLPEDYLYGKATKHLTYNDFINKELILFSNSDNERSIPSMV
DGLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSN
NLNLLQPIGQFGTRLHGGKDSASPRYIFTMLSPLARLLFPAKDDQTLKFLYDDNQRVEPE
WYIPIIPMVLINGAEGIGTGWSCKIPNFDVREVVNNIRRLMDGEEPLPMLPSYKNFKGTI
DELAPNQYVISGEVSIINSTTIEISELPVRTWTQVYKEQVLEPMLNGTDKTPPLITDYRE
YHTDTTVKFIVKMTEEKLAQAEHAGLHKVFKLQTNLTCNSMVLFDHVGCLKKYDTALDIL
RDFFDLRLKYYGLRKEWLTGMLGAESAKLNNQARFILEKIEGKIVIENKPKKELIKVLIQ
RGYDSDPVKAWKEAQQKSPGDNEEETEESDNEKETEKSDSATDSGPTFNYLLDMPLWYLT
KEKKDELCRQRTEKEQELENLKRKSPSDLWKEDLAAFVEELEVVEAKEKRDEQVGTIGKG
KAGGKPKAKKGQVAETLPSPHGRRVVPRVTVEMKAEAEKKIRKKIKTENIEGSPQEDSLD
PETLKQRLDKKLKTESGPKQKKQSKLPFKPIKKENKRNPWSDSESDLSCDESEFYAPPRE
TKSRRAVAANKKYTVDLDSDTDISDSKEEFQDEEDEDFIPSDGSSSKVKSVPKATKGQTT
SKVQEPPKSSPSHEGEDLEPEDTKDMALASSSSSTLDFPVELEIPDPVPKKSTAVKKTAA
KSQSSTSVTATKKRAAPKTSKKTSKTSLDSVSETSEKTVAAKSKKPRKRKPSNSDDSDSD
FGKGKSTAKAVKKSKMVDDDFQIDSNSSSTPVAPRARPGRAKKPIKYLEESDEDDMF
Download sequence
Identical sequences F7ABY1
XP_007482328.1.35504 ENSMODP00000016461 ENSMODP00000016461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]