SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016474 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016474
Domain Number 1 Region: 55-310
Classification Level Classification E-value
Superfamily ClpP/crotonase 8.2e-75
Family Crotonase-like 0.0000000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016474   Gene: ENSMODG00000013164   Transcript: ENSMODT00000016778
Sequence length 320
Comment pep:novel chromosome:BROADO5:4:382854601:382859122:-1 gene:ENSMODG00000013164 transcript:ENSMODT00000016778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVTSASRWLRSLLMRRLAASHSPHLCLRPLSSSQELAQSQAQDQDYESLKVTPVGEHV
LHVQMNRPEKRNAMNRAFWREMVECFNKIAQDPNCRAVVFSGAGKMFTSGIDLIDMAGDL
QPEGDDPARVSWNLRHFISKYQETFTVLEKCPKPVIAAVHGGCIGGGVDLISACDIRYCA
QDAWFQVKEVDIGLAADVGTLQRLPRIIGNQSLVNELAFTARKMMADEALSSGLVSRVLQ
DHESLLATAFALATEISTKSPLAVQGSKINLLYSRDHSVKDGLNFMAAWNMSMLQTQDIA
KSVEAAFQKKDLKSVTFSKL
Download sequence
Identical sequences F6ZM87
ENSMODP00000016474 XP_007491846.1.35504 ENSMODP00000016474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]