SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016481 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016481
Domain Number 1 Region: 166-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000948
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 2 Region: 136-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000804
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 211-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 4 Region: 85-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000396
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016481
Domain Number - Region: 57-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00536
Family EGF-type module 0.06
Further Details:      
 
Domain Number - Region: 31-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00566
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016481   Gene: ENSMODG00000013169   Transcript: ENSMODT00000016785
Sequence length 384
Comment pep:known chromosome:BROADO5:1:317463760:317499168:-1 gene:ENSMODG00000013169 transcript:ENSMODT00000016785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFALGSFLLLCLLGPPFGFFSALGLECEVDCHRDRGICEKDLCRCRPGWQGPLCNECVTF
PGCLHGSCSLPWQCICEDGWIGSLCDIDLQLCAAKPCPKNGTCTASEEGGSSCSCAPSSS
GRNCHFKEGPCVINGSPCQNGGACIDDNGLASYTSCLCPDGFSGNFCELNMNSCDPNPCE
NGGMCTDIGGDFHCRCPLGFMDKTCGRPVGDHCASGPCEHGGTCVPQARGGFECLCKPEF
SGPTCNHGHPNHSHPGPKTKRGPGLSDQFVPETQGRIATHQPSHRMLKITMRELTKNSKP
LLNESQAICFTILGVLTCLVVLGTISIVFFNKCEVWLSNAKYSRLLRKKKNLLLRYSNGD
EHTINIILPEKMNLKSYSKCLNEI
Download sequence
Identical sequences F6ZLP4
ENSMODP00000016481 ENSMODP00000016481 XP_007473347.1.35504 XP_007473348.1.35504 XP_007473349.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]